diff --git a/.gitignore b/.gitignore
index 79f2561..3d005f1 100644
--- a/.gitignore
+++ b/.gitignore
@@ -96,3 +96,6 @@ config.status
configure.scan
config.h
sysroot/
+.vscode/configurationCache.log
+.vscode/dryrun.log
+.vscode/targets.log
diff --git a/Docs/MANUAL.md b/Docs/MANUAL.md
index 60d542c..bab8cd8 100644
--- a/Docs/MANUAL.md
+++ b/Docs/MANUAL.md
@@ -713,7 +713,7 @@ mirror reject rookie talk pudding throw happy era myth already payment owner
## Uniform Resources (URs)
-Seedtool can encode and decode binary (hex) seeds, BIP39-encoded seeds, or SSKR-encoded shares in the Uniform Resource (UR) format. This format is defined in [BCR-0005: Uniform Resources (UR): Encoding Structured Binary Data for Transport in URIs and QR Codes](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0005-ur.md). The UR types supported for encoding and decoding are `crypto-seed`, `crypto-bip39` and `crypto-sskr`. These types are defined in [BCR-0006: Registry of Uniform Resource (UR) Types](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0006-urtypes.md).
+Seedtool can encode and decode binary (hex) seeds, BIP39-encoded seeds, or SSKR-encoded shares in the Uniform Resource (UR) format. This format is defined in [BCR-0005: Uniform Resources (UR): Encoding Structured Binary Data for Transport in URIs and QR Codes](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0005-ur.md). The UR types supported for encoding and decoding are `seed`, `crypto-bip39` and `crypto-sskr`. These types are defined in [BCR-0006: Registry of Uniform Resource (UR) Types](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0006-urtypes.md).
To encode the result of `seedtool` as a UR, supply the `--ur[=MAX_PART_LENGTH]` command line option. `MAX_PART_LENGTH` is a positive integer that sets the maximum number of characters allowed in a UR part. If a UR cannot be completely encoded in `MAX_PART_LENGTH` or fewer characters, it will be split into a number of roughly equal parts small enough to fall below the `MAX_PART_LENGTH` limit. The default for `MAX_PART_LENGTH` is 2500, and can be set higher or lower. Since `MAX_PART_LENGTH` is optional, it *must* be supplied after an equal sign:
@@ -721,12 +721,12 @@ To encode the result of `seedtool` as a UR, supply the `--ur[=MAX_PART_LENGTH]`
# OK:
$ seedtool --ur
-ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
+ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
# OK, UR is still small enough to be encoded in one part
$ seedtool --ur=500
-ur:crypto-seed/oyadgdheasgwhlglcelagovsfsrspywklansfdvadshlhl
+ur:seed/oyadgdheasgwhlglcelagovsfsrspywklansfdvadshlhl
# Illegal: Optional values must be defined using equal sign.
@@ -742,7 +742,7 @@ seedtool: MAX_FRAGMENT_LENGTH must be >= 10.
To decode a UR in one of the supported formats, use the UR input method `--in ur`.
```
-$ seedtool --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
+$ seedtool --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
66e9060071faeaeed5d045363a868ef4
```
@@ -750,7 +750,7 @@ As in other cases, input may be supplied on separate lines and terminated by `^D
```
$ seedtool --in ur
-ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
+ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
^D
66e9060071faeaeed5d045363a868ef4
```
@@ -758,14 +758,14 @@ ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
As with other input and output methods, seedtool operates in either encoding mode or decoding mode. Thus it is illegal to combine the `--ur` option with the `--in ur` input method.
```
-$ seedtool --ur --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
+$ seedtool --ur --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro
seedtool: The --ur option may not be combined with the --in ur input method.
```
The following example pipes the output of one invocation of seedtool to another, first decoding a binary seed UR to hex, and then re-encoding that hex seed as BIP39.
```
-$ seedtool --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro | seedtool --out bip39 --ur
+$ seedtool --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro | seedtool --out bip39 --ur
ur:crypto-bip39/oyadlkiyiajpjlkpiaisiejzjljtioiojyjlidhsiaiajlieiajljpjtiejzjlhsjtiykohsjzjzihkkiejzinjnidiyjnjljnihjtjyiyktinjtjyihjpiektisinjoioiskpjtiejpihieiyjkinjzkoihjpteaycyem
#
@@ -796,7 +796,7 @@ The UR format is designed to be efficiently transmitted in QR codes, because it
```
$ seedtool --ur | tr '[:lower:]' '[:upper:]'
-UR:CRYPTO-SEED/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY
+UR:seed/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY
```
```
@@ -812,7 +812,7 @@ UR:CRYPTO-SEED/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY
#
$ seedtool --ur | tr '[:lower:]' '[:upper:]' | tee /dev/tty | tr -d '\n' | qrencode -o seedqrcode.png -l L
-UR:CRYPTO-SEED/OYADGDCPCNKOCSNNQDCKUEGABKMUZMYNSGGUBDRYTYVTSN
+UR:SEED/OYADGDCPCNKOCSNNQDCKUEGABKMUZMYNSGGUBDRYTYVTSN
```
`seedqrcode.png`:
@@ -840,22 +840,22 @@ When a UR encoding must be broken up into parts, seedtool prints each part on a
```
$ seedtool --count 400 --ur=100
-ur:crypto-seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd
-ur:crypto-seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih
-ur:crypto-seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm
-ur:crypto-seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs
-ur:crypto-seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm
+ur:seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd
+ur:seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih
+ur:seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm
+ur:seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs
+ur:seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm
```
The original seed can be recovered from the above:
```
$ seedtool --in ur
-ur:crypto-seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd
-ur:crypto-seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih
-ur:crypto-seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm
-ur:crypto-seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs
-ur:crypto-seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm
+ur:seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd
+ur:seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih
+ur:seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm
+ur:seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs
+ur:seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm
^D
f65d661fe895f8eaeb70f76f8d923c9a503ea82b6a7b9857bfe2fdd625041f172ba24c1834569bc1ae821886075d77662d2815bc3d8f628ff3d7d5fe3ad727b1534db3778a66a006e2e25fbfc429147873736c92acc48f5957dfa2ab85a020a5fc7f573116576bf7a43558c5b8e7f6d5f846fbb005cc3e764c529e6efa645cd1c6747746009e5f2d761c6ba6ad7f675633d4adf86f834820f4e3be2852678d776454783d94ecaddd544fa68fa4c9f7b4abab8a5841563512d59aff5022cd9172dd2b0053022bee459c0e1a94d24af10d0c88feb80cfde6f127fe4f3af1b731b54aa0b7590501a0c56c9c5c790ec3f7125fb2223590543cbf548213626baa66d9a9a8a2c3424483d83b4fbc43ee27fea5660a9847378a288e059a91b67377f1c0ac4ed42c30b7c91489798d5d0c1bfabd479175e42b3910778d10f6d4a7da50da1953eda9b80948ead6c94230006cdd715d593fddf67e4ef1f04ce69a21dfe431a741d6b645c0ec3824ed52c29610116bc37f57bdc76d948e669af1700eefc71ce660359c043082ea8100ba2507256d13
```
@@ -870,51 +870,51 @@ When encoding a multi-part UR, seedtool outputs the minimum number of parts need
#
$ seedtool --count 300 --deterministic TEST --ur=50
-ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
-ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
-ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
-ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
-ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
-ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
-ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
+ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
+ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
+ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
+ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
+ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
+ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
+ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
#
# Generate the same multi-part UR, but add 10 additional parts
#
$ seedtool --deterministic TEST --count 300 --ur=50 --parts 10
-ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
-ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
-ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
-ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
-ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
-ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
-ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
-ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
-ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
-ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
-ur:crypto-seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti
-ur:crypto-seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg
-ur:crypto-seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk
-ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
-ur:crypto-seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb
-ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
-ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe
+ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
+ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
+ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
+ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
+ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
+ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
+ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
+ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
+ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
+ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
+ur:seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti
+ur:seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg
+ur:seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk
+ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
+ur:seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb
+ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
+ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe
#
# Reconstruct the message from a subset of the generated parts.
#
$ seedtool --in ur
-ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
-ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
-ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
-ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
-ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
-ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
-ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
-ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
-ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
-ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe
+ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
+ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
+ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
+ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
+ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
+ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
+ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
+ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
+ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
+ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe
^D
9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af
```
@@ -950,11 +950,11 @@ ur:crypto-sskr/taadecgoretkaeadaoeeoystlowdrlutylgllaampyfwswwppsaocfbtns
### 0.10.0, 12/15/2020
-* Now parses (and ignores) the `name` and `note` fields of a `ur:crypto-seed` given as input.
+* Now parses (and ignores) the `name` and `note` fields of a `ur:seed` given as input.
### 0.9.1, 10/13/2020
-* Removed `birthdate` field from generated `ur:crypto-seed` URs, which was causing unit tests to become invalid. A specific flag to set the `birthdate` field could be added at a later date.
+* Removed `birthdate` field from generated `ur:seed` URs, which was causing unit tests to become invalid. A specific flag to set the `birthdate` field could be added at a later date.
### 0.9.0, 10/4/2020
diff --git a/Docs/Usage.md b/Docs/Usage.md
index 97341d5..a37336e 100644
--- a/Docs/Usage.md
+++ b/Docs/Usage.md
@@ -83,7 +83,7 @@ tuna acid epic gyro many meow able acid also girl void oval fish exam veto gala
```
$ seedtool --ur | tr [:lower:] [:upper:] | tee /dev/tty | qrencode -o seedqrcode.png -l L
-UR:CRYPTO-SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK
+UR:SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK
```
@@ -92,37 +92,36 @@ UR:CRYPTO-SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK
```
$ seedtool --deterministic=TEST --count 64 --ur=20
-ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
-ur:crypto-seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg
-ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
-ur:crypto-seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln
+ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
+ur:seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg
+ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
+ur:seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln
```
### Same as above, but generate 5 additional parts using fountain codes
```
$ seedtool --deterministic=TEST --count 64 --ur=20 --parts 5
-ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
-ur:crypto-seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg
-ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
-ur:crypto-seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln
-ur:crypto-seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst
-ur:crypto-seed/6-4/lpamaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywylofxjerl
-ur:crypto-seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt
-ur:crypto-seed/8-4/lpayaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsykpamtlp
-ur:crypto-seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss
+ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
+ur:seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg
+ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
+ur:seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln
+ur:seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst
+ur:seed/6-4/lpamaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywylofxjerl
+ur:seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt
+ur:seed/8-4/lpayaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsykpamtlp
+ur:seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss
```
### Recover the seed from UR using a subset of the generated parts
```
$ seedtool --in ur
-ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
-ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
-ur:crypto-seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst
-ur:crypto-seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt
-ur:crypto-seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss
+ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh
+ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw
+ur:seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst
+ur:seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt
+ur:seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss
^D
9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e
```
-
diff --git a/build-aux/config.guess b/build-aux/config.guess
new file mode 100755
index 0000000..1972fda
--- /dev/null
+++ b/build-aux/config.guess
@@ -0,0 +1,1700 @@
+#! /bin/sh
+# Attempt to guess a canonical system name.
+# Copyright 1992-2021 Free Software Foundation, Inc.
+
+timestamp='2021-01-25'
+
+# This file is free software; you can redistribute it and/or modify it
+# under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 3 of the License, or
+# (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful, but
+# WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+# General Public License for more details.
+#
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, see .
+#
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that
+# program. This Exception is an additional permission under section 7
+# of the GNU General Public License, version 3 ("GPLv3").
+#
+# Originally written by Per Bothner; maintained since 2000 by Ben Elliston.
+#
+# You can get the latest version of this script from:
+# https://git.savannah.gnu.org/cgit/config.git/plain/config.guess
+#
+# Please send patches to .
+
+
+me=$(echo "$0" | sed -e 's,.*/,,')
+
+usage="\
+Usage: $0 [OPTION]
+
+Output the configuration name of the system \`$me' is run on.
+
+Options:
+ -h, --help print this help, then exit
+ -t, --time-stamp print date of last modification, then exit
+ -v, --version print version number, then exit
+
+Report bugs and patches to ."
+
+version="\
+GNU config.guess ($timestamp)
+
+Originally written by Per Bothner.
+Copyright 1992-2021 Free Software Foundation, Inc.
+
+This is free software; see the source for copying conditions. There is NO
+warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE."
+
+help="
+Try \`$me --help' for more information."
+
+# Parse command line
+while test $# -gt 0 ; do
+ case $1 in
+ --time-stamp | --time* | -t )
+ echo "$timestamp" ; exit ;;
+ --version | -v )
+ echo "$version" ; exit ;;
+ --help | --h* | -h )
+ echo "$usage"; exit ;;
+ -- ) # Stop option processing
+ shift; break ;;
+ - ) # Use stdin as input.
+ break ;;
+ -* )
+ echo "$me: invalid option $1$help" >&2
+ exit 1 ;;
+ * )
+ break ;;
+ esac
+done
+
+if test $# != 0; then
+ echo "$me: too many arguments$help" >&2
+ exit 1
+fi
+
+# CC_FOR_BUILD -- compiler used by this script. Note that the use of a
+# compiler to aid in system detection is discouraged as it requires
+# temporary files to be created and, as you can see below, it is a
+# headache to deal with in a portable fashion.
+
+# Historically, `CC_FOR_BUILD' used to be named `HOST_CC'. We still
+# use `HOST_CC' if defined, but it is deprecated.
+
+# Portable tmp directory creation inspired by the Autoconf team.
+
+tmp=
+# shellcheck disable=SC2172
+trap 'test -z "$tmp" || rm -fr "$tmp"' 0 1 2 13 15
+
+set_cc_for_build() {
+ # prevent multiple calls if $tmp is already set
+ test "$tmp" && return 0
+ : "${TMPDIR=/tmp}"
+ # shellcheck disable=SC2039
+ { tmp=$( (umask 077 && mktemp -d "$TMPDIR/cgXXXXXX") 2>/dev/null) && test -n "$tmp" && test -d "$tmp" ; } ||
+ { test -n "$RANDOM" && tmp=$TMPDIR/cg$$-$RANDOM && (umask 077 && mkdir "$tmp" 2>/dev/null) ; } ||
+ { tmp=$TMPDIR/cg-$$ && (umask 077 && mkdir "$tmp" 2>/dev/null) && echo "Warning: creating insecure temp directory" >&2 ; } ||
+ { echo "$me: cannot create a temporary directory in $TMPDIR" >&2 ; exit 1 ; }
+ dummy=$tmp/dummy
+ case ${CC_FOR_BUILD-},${HOST_CC-},${CC-} in
+ ,,) echo "int x;" > "$dummy.c"
+ for driver in cc gcc c89 c99 ; do
+ if ($driver -c -o "$dummy.o" "$dummy.c") >/dev/null 2>&1 ; then
+ CC_FOR_BUILD="$driver"
+ break
+ fi
+ done
+ if test x"$CC_FOR_BUILD" = x ; then
+ CC_FOR_BUILD=no_compiler_found
+ fi
+ ;;
+ ,,*) CC_FOR_BUILD=$CC ;;
+ ,*,*) CC_FOR_BUILD=$HOST_CC ;;
+ esac
+}
+
+# This is needed to find uname on a Pyramid OSx when run in the BSD universe.
+# (ghazi@noc.rutgers.edu 1994-08-24)
+if test -f /.attbin/uname ; then
+ PATH=$PATH:/.attbin ; export PATH
+fi
+
+UNAME_MACHINE=$( (uname -m) 2>/dev/null) || UNAME_MACHINE=unknown
+UNAME_RELEASE=$( (uname -r) 2>/dev/null) || UNAME_RELEASE=unknown
+UNAME_SYSTEM=$( (uname -s) 2>/dev/null) || UNAME_SYSTEM=unknown
+UNAME_VERSION=$( (uname -v) 2>/dev/null) || UNAME_VERSION=unknown
+
+case "$UNAME_SYSTEM" in
+Linux|GNU|GNU/*)
+ LIBC=unknown
+
+ set_cc_for_build
+ cat <<-EOF > "$dummy.c"
+ #include
+ #if defined(__UCLIBC__)
+ LIBC=uclibc
+ #elif defined(__dietlibc__)
+ LIBC=dietlibc
+ #elif defined(__GLIBC__)
+ LIBC=gnu
+ #else
+ #include
+ /* First heuristic to detect musl libc. */
+ #ifdef __DEFINED_va_list
+ LIBC=musl
+ #endif
+ #endif
+ EOF
+ eval "$($CC_FOR_BUILD -E "$dummy.c" 2>/dev/null | grep '^LIBC' | sed 's, ,,g')"
+
+ # Second heuristic to detect musl libc.
+ if [ "$LIBC" = unknown ] &&
+ command -v ldd >/dev/null &&
+ ldd --version 2>&1 | grep -q ^musl; then
+ LIBC=musl
+ fi
+
+ # If the system lacks a compiler, then just pick glibc.
+ # We could probably try harder.
+ if [ "$LIBC" = unknown ]; then
+ LIBC=gnu
+ fi
+ ;;
+esac
+
+# Note: order is significant - the case branches are not exclusive.
+
+case "$UNAME_MACHINE:$UNAME_SYSTEM:$UNAME_RELEASE:$UNAME_VERSION" in
+ *:NetBSD:*:*)
+ # NetBSD (nbsd) targets should (where applicable) match one or
+ # more of the tuples: *-*-netbsdelf*, *-*-netbsdaout*,
+ # *-*-netbsdecoff* and *-*-netbsd*. For targets that recently
+ # switched to ELF, *-*-netbsd* would select the old
+ # object file format. This provides both forward
+ # compatibility and a consistent mechanism for selecting the
+ # object file format.
+ #
+ # Note: NetBSD doesn't particularly care about the vendor
+ # portion of the name. We always set it to "unknown".
+ UNAME_MACHINE_ARCH=$( (uname -p 2>/dev/null || \
+ /sbin/sysctl -n hw.machine_arch 2>/dev/null || \
+ /usr/sbin/sysctl -n hw.machine_arch 2>/dev/null || \
+ echo unknown))
+ case "$UNAME_MACHINE_ARCH" in
+ aarch64eb) machine=aarch64_be-unknown ;;
+ armeb) machine=armeb-unknown ;;
+ arm*) machine=arm-unknown ;;
+ sh3el) machine=shl-unknown ;;
+ sh3eb) machine=sh-unknown ;;
+ sh5el) machine=sh5le-unknown ;;
+ earmv*)
+ arch=$(echo "$UNAME_MACHINE_ARCH" | sed -e 's,^e\(armv[0-9]\).*$,\1,')
+ endian=$(echo "$UNAME_MACHINE_ARCH" | sed -ne 's,^.*\(eb\)$,\1,p')
+ machine="${arch}${endian}"-unknown
+ ;;
+ *) machine="$UNAME_MACHINE_ARCH"-unknown ;;
+ esac
+ # The Operating System including object format, if it has switched
+ # to ELF recently (or will in the future) and ABI.
+ case "$UNAME_MACHINE_ARCH" in
+ earm*)
+ os=netbsdelf
+ ;;
+ arm*|i386|m68k|ns32k|sh3*|sparc|vax)
+ set_cc_for_build
+ if echo __ELF__ | $CC_FOR_BUILD -E - 2>/dev/null \
+ | grep -q __ELF__
+ then
+ # Once all utilities can be ECOFF (netbsdecoff) or a.out (netbsdaout).
+ # Return netbsd for either. FIX?
+ os=netbsd
+ else
+ os=netbsdelf
+ fi
+ ;;
+ *)
+ os=netbsd
+ ;;
+ esac
+ # Determine ABI tags.
+ case "$UNAME_MACHINE_ARCH" in
+ earm*)
+ expr='s/^earmv[0-9]/-eabi/;s/eb$//'
+ abi=$(echo "$UNAME_MACHINE_ARCH" | sed -e "$expr")
+ ;;
+ esac
+ # The OS release
+ # Debian GNU/NetBSD machines have a different userland, and
+ # thus, need a distinct triplet. However, they do not need
+ # kernel version information, so it can be replaced with a
+ # suitable tag, in the style of linux-gnu.
+ case "$UNAME_VERSION" in
+ Debian*)
+ release='-gnu'
+ ;;
+ *)
+ release=$(echo "$UNAME_RELEASE" | sed -e 's/[-_].*//' | cut -d. -f1,2)
+ ;;
+ esac
+ # Since CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM:
+ # contains redundant information, the shorter form:
+ # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used.
+ echo "$machine-${os}${release}${abi-}"
+ exit ;;
+ *:Bitrig:*:*)
+ UNAME_MACHINE_ARCH=$(arch | sed 's/Bitrig.//')
+ echo "$UNAME_MACHINE_ARCH"-unknown-bitrig"$UNAME_RELEASE"
+ exit ;;
+ *:OpenBSD:*:*)
+ UNAME_MACHINE_ARCH=$(arch | sed 's/OpenBSD.//')
+ echo "$UNAME_MACHINE_ARCH"-unknown-openbsd"$UNAME_RELEASE"
+ exit ;;
+ *:LibertyBSD:*:*)
+ UNAME_MACHINE_ARCH=$(arch | sed 's/^.*BSD\.//')
+ echo "$UNAME_MACHINE_ARCH"-unknown-libertybsd"$UNAME_RELEASE"
+ exit ;;
+ *:MidnightBSD:*:*)
+ echo "$UNAME_MACHINE"-unknown-midnightbsd"$UNAME_RELEASE"
+ exit ;;
+ *:ekkoBSD:*:*)
+ echo "$UNAME_MACHINE"-unknown-ekkobsd"$UNAME_RELEASE"
+ exit ;;
+ *:SolidBSD:*:*)
+ echo "$UNAME_MACHINE"-unknown-solidbsd"$UNAME_RELEASE"
+ exit ;;
+ *:OS108:*:*)
+ echo "$UNAME_MACHINE"-unknown-os108_"$UNAME_RELEASE"
+ exit ;;
+ macppc:MirBSD:*:*)
+ echo powerpc-unknown-mirbsd"$UNAME_RELEASE"
+ exit ;;
+ *:MirBSD:*:*)
+ echo "$UNAME_MACHINE"-unknown-mirbsd"$UNAME_RELEASE"
+ exit ;;
+ *:Sortix:*:*)
+ echo "$UNAME_MACHINE"-unknown-sortix
+ exit ;;
+ *:Twizzler:*:*)
+ echo "$UNAME_MACHINE"-unknown-twizzler
+ exit ;;
+ *:Redox:*:*)
+ echo "$UNAME_MACHINE"-unknown-redox
+ exit ;;
+ mips:OSF1:*.*)
+ echo mips-dec-osf1
+ exit ;;
+ alpha:OSF1:*:*)
+ case $UNAME_RELEASE in
+ *4.0)
+ UNAME_RELEASE=$(/usr/sbin/sizer -v | awk '{print $3}')
+ ;;
+ *5.*)
+ UNAME_RELEASE=$(/usr/sbin/sizer -v | awk '{print $4}')
+ ;;
+ esac
+ # According to Compaq, /usr/sbin/psrinfo has been available on
+ # OSF/1 and Tru64 systems produced since 1995. I hope that
+ # covers most systems running today. This code pipes the CPU
+ # types through head -n 1, so we only detect the type of CPU 0.
+ ALPHA_CPU_TYPE=$(/usr/sbin/psrinfo -v | sed -n -e 's/^ The alpha \(.*\) processor.*$/\1/p' | head -n 1)
+ case "$ALPHA_CPU_TYPE" in
+ "EV4 (21064)")
+ UNAME_MACHINE=alpha ;;
+ "EV4.5 (21064)")
+ UNAME_MACHINE=alpha ;;
+ "LCA4 (21066/21068)")
+ UNAME_MACHINE=alpha ;;
+ "EV5 (21164)")
+ UNAME_MACHINE=alphaev5 ;;
+ "EV5.6 (21164A)")
+ UNAME_MACHINE=alphaev56 ;;
+ "EV5.6 (21164PC)")
+ UNAME_MACHINE=alphapca56 ;;
+ "EV5.7 (21164PC)")
+ UNAME_MACHINE=alphapca57 ;;
+ "EV6 (21264)")
+ UNAME_MACHINE=alphaev6 ;;
+ "EV6.7 (21264A)")
+ UNAME_MACHINE=alphaev67 ;;
+ "EV6.8CB (21264C)")
+ UNAME_MACHINE=alphaev68 ;;
+ "EV6.8AL (21264B)")
+ UNAME_MACHINE=alphaev68 ;;
+ "EV6.8CX (21264D)")
+ UNAME_MACHINE=alphaev68 ;;
+ "EV6.9A (21264/EV69A)")
+ UNAME_MACHINE=alphaev69 ;;
+ "EV7 (21364)")
+ UNAME_MACHINE=alphaev7 ;;
+ "EV7.9 (21364A)")
+ UNAME_MACHINE=alphaev79 ;;
+ esac
+ # A Pn.n version is a patched version.
+ # A Vn.n version is a released version.
+ # A Tn.n version is a released field test version.
+ # A Xn.n version is an unreleased experimental baselevel.
+ # 1.2 uses "1.2" for uname -r.
+ echo "$UNAME_MACHINE"-dec-osf"$(echo "$UNAME_RELEASE" | sed -e 's/^[PVTX]//' | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz)"
+ # Reset EXIT trap before exiting to avoid spurious non-zero exit code.
+ exitcode=$?
+ trap '' 0
+ exit $exitcode ;;
+ Amiga*:UNIX_System_V:4.0:*)
+ echo m68k-unknown-sysv4
+ exit ;;
+ *:[Aa]miga[Oo][Ss]:*:*)
+ echo "$UNAME_MACHINE"-unknown-amigaos
+ exit ;;
+ *:[Mm]orph[Oo][Ss]:*:*)
+ echo "$UNAME_MACHINE"-unknown-morphos
+ exit ;;
+ *:OS/390:*:*)
+ echo i370-ibm-openedition
+ exit ;;
+ *:z/VM:*:*)
+ echo s390-ibm-zvmoe
+ exit ;;
+ *:OS400:*:*)
+ echo powerpc-ibm-os400
+ exit ;;
+ arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*)
+ echo arm-acorn-riscix"$UNAME_RELEASE"
+ exit ;;
+ arm*:riscos:*:*|arm*:RISCOS:*:*)
+ echo arm-unknown-riscos
+ exit ;;
+ SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*)
+ echo hppa1.1-hitachi-hiuxmpp
+ exit ;;
+ Pyramid*:OSx*:*:* | MIS*:OSx*:*:* | MIS*:SMP_DC-OSx*:*:*)
+ # akee@wpdis03.wpafb.af.mil (Earle F. Ake) contributed MIS and NILE.
+ if test "$( (/bin/universe) 2>/dev/null)" = att ; then
+ echo pyramid-pyramid-sysv3
+ else
+ echo pyramid-pyramid-bsd
+ fi
+ exit ;;
+ NILE*:*:*:dcosx)
+ echo pyramid-pyramid-svr4
+ exit ;;
+ DRS?6000:unix:4.0:6*)
+ echo sparc-icl-nx6
+ exit ;;
+ DRS?6000:UNIX_SV:4.2*:7* | DRS?6000:isis:4.2*:7*)
+ case $(/usr/bin/uname -p) in
+ sparc) echo sparc-icl-nx7; exit ;;
+ esac ;;
+ s390x:SunOS:*:*)
+ echo "$UNAME_MACHINE"-ibm-solaris2"$(echo "$UNAME_RELEASE" | sed -e 's/[^.]*//')"
+ exit ;;
+ sun4H:SunOS:5.*:*)
+ echo sparc-hal-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')"
+ exit ;;
+ sun4*:SunOS:5.*:* | tadpole*:SunOS:5.*:*)
+ echo sparc-sun-solaris2"$(echo "$UNAME_RELEASE" | sed -e 's/[^.]*//')"
+ exit ;;
+ i86pc:AuroraUX:5.*:* | i86xen:AuroraUX:5.*:*)
+ echo i386-pc-auroraux"$UNAME_RELEASE"
+ exit ;;
+ i86pc:SunOS:5.*:* | i86xen:SunOS:5.*:*)
+ set_cc_for_build
+ SUN_ARCH=i386
+ # If there is a compiler, see if it is configured for 64-bit objects.
+ # Note that the Sun cc does not turn __LP64__ into 1 like gcc does.
+ # This test works for both compilers.
+ if test "$CC_FOR_BUILD" != no_compiler_found; then
+ if (echo '#ifdef __amd64'; echo IS_64BIT_ARCH; echo '#endif') | \
+ (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \
+ grep IS_64BIT_ARCH >/dev/null
+ then
+ SUN_ARCH=x86_64
+ fi
+ fi
+ echo "$SUN_ARCH"-pc-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')"
+ exit ;;
+ sun4*:SunOS:6*:*)
+ # According to config.sub, this is the proper way to canonicalize
+ # SunOS6. Hard to guess exactly what SunOS6 will be like, but
+ # it's likely to be more like Solaris than SunOS4.
+ echo sparc-sun-solaris3"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')"
+ exit ;;
+ sun4*:SunOS:*:*)
+ case "$(/usr/bin/arch -k)" in
+ Series*|S4*)
+ UNAME_RELEASE=$(uname -v)
+ ;;
+ esac
+ # Japanese Language versions have a version number like `4.1.3-JL'.
+ echo sparc-sun-sunos"$(echo "$UNAME_RELEASE"|sed -e 's/-/_/')"
+ exit ;;
+ sun3*:SunOS:*:*)
+ echo m68k-sun-sunos"$UNAME_RELEASE"
+ exit ;;
+ sun*:*:4.2BSD:*)
+ UNAME_RELEASE=$( (sed 1q /etc/motd | awk '{print substr($5,1,3)}') 2>/dev/null)
+ test "x$UNAME_RELEASE" = x && UNAME_RELEASE=3
+ case "$(/bin/arch)" in
+ sun3)
+ echo m68k-sun-sunos"$UNAME_RELEASE"
+ ;;
+ sun4)
+ echo sparc-sun-sunos"$UNAME_RELEASE"
+ ;;
+ esac
+ exit ;;
+ aushp:SunOS:*:*)
+ echo sparc-auspex-sunos"$UNAME_RELEASE"
+ exit ;;
+ # The situation for MiNT is a little confusing. The machine name
+ # can be virtually everything (everything which is not
+ # "atarist" or "atariste" at least should have a processor
+ # > m68000). The system name ranges from "MiNT" over "FreeMiNT"
+ # to the lowercase version "mint" (or "freemint"). Finally
+ # the system name "TOS" denotes a system which is actually not
+ # MiNT. But MiNT is downward compatible to TOS, so this should
+ # be no problem.
+ atarist[e]:*MiNT:*:* | atarist[e]:*mint:*:* | atarist[e]:*TOS:*:*)
+ echo m68k-atari-mint"$UNAME_RELEASE"
+ exit ;;
+ atari*:*MiNT:*:* | atari*:*mint:*:* | atarist[e]:*TOS:*:*)
+ echo m68k-atari-mint"$UNAME_RELEASE"
+ exit ;;
+ *falcon*:*MiNT:*:* | *falcon*:*mint:*:* | *falcon*:*TOS:*:*)
+ echo m68k-atari-mint"$UNAME_RELEASE"
+ exit ;;
+ milan*:*MiNT:*:* | milan*:*mint:*:* | *milan*:*TOS:*:*)
+ echo m68k-milan-mint"$UNAME_RELEASE"
+ exit ;;
+ hades*:*MiNT:*:* | hades*:*mint:*:* | *hades*:*TOS:*:*)
+ echo m68k-hades-mint"$UNAME_RELEASE"
+ exit ;;
+ *:*MiNT:*:* | *:*mint:*:* | *:*TOS:*:*)
+ echo m68k-unknown-mint"$UNAME_RELEASE"
+ exit ;;
+ m68k:machten:*:*)
+ echo m68k-apple-machten"$UNAME_RELEASE"
+ exit ;;
+ powerpc:machten:*:*)
+ echo powerpc-apple-machten"$UNAME_RELEASE"
+ exit ;;
+ RISC*:Mach:*:*)
+ echo mips-dec-mach_bsd4.3
+ exit ;;
+ RISC*:ULTRIX:*:*)
+ echo mips-dec-ultrix"$UNAME_RELEASE"
+ exit ;;
+ VAX*:ULTRIX*:*:*)
+ echo vax-dec-ultrix"$UNAME_RELEASE"
+ exit ;;
+ 2020:CLIX:*:* | 2430:CLIX:*:*)
+ echo clipper-intergraph-clix"$UNAME_RELEASE"
+ exit ;;
+ mips:*:*:UMIPS | mips:*:*:RISCos)
+ set_cc_for_build
+ sed 's/^ //' << EOF > "$dummy.c"
+#ifdef __cplusplus
+#include /* for printf() prototype */
+ int main (int argc, char *argv[]) {
+#else
+ int main (argc, argv) int argc; char *argv[]; {
+#endif
+ #if defined (host_mips) && defined (MIPSEB)
+ #if defined (SYSTYPE_SYSV)
+ printf ("mips-mips-riscos%ssysv\\n", argv[1]); exit (0);
+ #endif
+ #if defined (SYSTYPE_SVR4)
+ printf ("mips-mips-riscos%ssvr4\\n", argv[1]); exit (0);
+ #endif
+ #if defined (SYSTYPE_BSD43) || defined(SYSTYPE_BSD)
+ printf ("mips-mips-riscos%sbsd\\n", argv[1]); exit (0);
+ #endif
+ #endif
+ exit (-1);
+ }
+EOF
+ $CC_FOR_BUILD -o "$dummy" "$dummy.c" &&
+ dummyarg=$(echo "$UNAME_RELEASE" | sed -n 's/\([0-9]*\).*/\1/p') &&
+ SYSTEM_NAME=$("$dummy" "$dummyarg") &&
+ { echo "$SYSTEM_NAME"; exit; }
+ echo mips-mips-riscos"$UNAME_RELEASE"
+ exit ;;
+ Motorola:PowerMAX_OS:*:*)
+ echo powerpc-motorola-powermax
+ exit ;;
+ Motorola:*:4.3:PL8-*)
+ echo powerpc-harris-powermax
+ exit ;;
+ Night_Hawk:*:*:PowerMAX_OS | Synergy:PowerMAX_OS:*:*)
+ echo powerpc-harris-powermax
+ exit ;;
+ Night_Hawk:Power_UNIX:*:*)
+ echo powerpc-harris-powerunix
+ exit ;;
+ m88k:CX/UX:7*:*)
+ echo m88k-harris-cxux7
+ exit ;;
+ m88k:*:4*:R4*)
+ echo m88k-motorola-sysv4
+ exit ;;
+ m88k:*:3*:R3*)
+ echo m88k-motorola-sysv3
+ exit ;;
+ AViiON:dgux:*:*)
+ # DG/UX returns AViiON for all architectures
+ UNAME_PROCESSOR=$(/usr/bin/uname -p)
+ if test "$UNAME_PROCESSOR" = mc88100 || test "$UNAME_PROCESSOR" = mc88110
+ then
+ if test "$TARGET_BINARY_INTERFACE"x = m88kdguxelfx || \
+ test "$TARGET_BINARY_INTERFACE"x = x
+ then
+ echo m88k-dg-dgux"$UNAME_RELEASE"
+ else
+ echo m88k-dg-dguxbcs"$UNAME_RELEASE"
+ fi
+ else
+ echo i586-dg-dgux"$UNAME_RELEASE"
+ fi
+ exit ;;
+ M88*:DolphinOS:*:*) # DolphinOS (SVR3)
+ echo m88k-dolphin-sysv3
+ exit ;;
+ M88*:*:R3*:*)
+ # Delta 88k system running SVR3
+ echo m88k-motorola-sysv3
+ exit ;;
+ XD88*:*:*:*) # Tektronix XD88 system running UTekV (SVR3)
+ echo m88k-tektronix-sysv3
+ exit ;;
+ Tek43[0-9][0-9]:UTek:*:*) # Tektronix 4300 system running UTek (BSD)
+ echo m68k-tektronix-bsd
+ exit ;;
+ *:IRIX*:*:*)
+ echo mips-sgi-irix"$(echo "$UNAME_RELEASE"|sed -e 's/-/_/g')"
+ exit ;;
+ ????????:AIX?:[12].1:2) # AIX 2.2.1 or AIX 2.1.1 is RT/PC AIX.
+ echo romp-ibm-aix # uname -m gives an 8 hex-code CPU id
+ exit ;; # Note that: echo "'$(uname -s)'" gives 'AIX '
+ i*86:AIX:*:*)
+ echo i386-ibm-aix
+ exit ;;
+ ia64:AIX:*:*)
+ if test -x /usr/bin/oslevel ; then
+ IBM_REV=$(/usr/bin/oslevel)
+ else
+ IBM_REV="$UNAME_VERSION.$UNAME_RELEASE"
+ fi
+ echo "$UNAME_MACHINE"-ibm-aix"$IBM_REV"
+ exit ;;
+ *:AIX:2:3)
+ if grep bos325 /usr/include/stdio.h >/dev/null 2>&1; then
+ set_cc_for_build
+ sed 's/^ //' << EOF > "$dummy.c"
+ #include
+
+ main()
+ {
+ if (!__power_pc())
+ exit(1);
+ puts("powerpc-ibm-aix3.2.5");
+ exit(0);
+ }
+EOF
+ if $CC_FOR_BUILD -o "$dummy" "$dummy.c" && SYSTEM_NAME=$("$dummy")
+ then
+ echo "$SYSTEM_NAME"
+ else
+ echo rs6000-ibm-aix3.2.5
+ fi
+ elif grep bos324 /usr/include/stdio.h >/dev/null 2>&1; then
+ echo rs6000-ibm-aix3.2.4
+ else
+ echo rs6000-ibm-aix3.2
+ fi
+ exit ;;
+ *:AIX:*:[4567])
+ IBM_CPU_ID=$(/usr/sbin/lsdev -C -c processor -S available | sed 1q | awk '{ print $1 }')
+ if /usr/sbin/lsattr -El "$IBM_CPU_ID" | grep ' POWER' >/dev/null 2>&1; then
+ IBM_ARCH=rs6000
+ else
+ IBM_ARCH=powerpc
+ fi
+ if test -x /usr/bin/lslpp ; then
+ IBM_REV=$(/usr/bin/lslpp -Lqc bos.rte.libc |
+ awk -F: '{ print $3 }' | sed s/[0-9]*$/0/)
+ else
+ IBM_REV="$UNAME_VERSION.$UNAME_RELEASE"
+ fi
+ echo "$IBM_ARCH"-ibm-aix"$IBM_REV"
+ exit ;;
+ *:AIX:*:*)
+ echo rs6000-ibm-aix
+ exit ;;
+ ibmrt:4.4BSD:*|romp-ibm:4.4BSD:*)
+ echo romp-ibm-bsd4.4
+ exit ;;
+ ibmrt:*BSD:*|romp-ibm:BSD:*) # covers RT/PC BSD and
+ echo romp-ibm-bsd"$UNAME_RELEASE" # 4.3 with uname added to
+ exit ;; # report: romp-ibm BSD 4.3
+ *:BOSX:*:*)
+ echo rs6000-bull-bosx
+ exit ;;
+ DPX/2?00:B.O.S.:*:*)
+ echo m68k-bull-sysv3
+ exit ;;
+ 9000/[34]??:4.3bsd:1.*:*)
+ echo m68k-hp-bsd
+ exit ;;
+ hp300:4.4BSD:*:* | 9000/[34]??:4.3bsd:2.*:*)
+ echo m68k-hp-bsd4.4
+ exit ;;
+ 9000/[34678]??:HP-UX:*:*)
+ HPUX_REV=$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*.[0B]*//')
+ case "$UNAME_MACHINE" in
+ 9000/31?) HP_ARCH=m68000 ;;
+ 9000/[34]??) HP_ARCH=m68k ;;
+ 9000/[678][0-9][0-9])
+ if test -x /usr/bin/getconf; then
+ sc_cpu_version=$(/usr/bin/getconf SC_CPU_VERSION 2>/dev/null)
+ sc_kernel_bits=$(/usr/bin/getconf SC_KERNEL_BITS 2>/dev/null)
+ case "$sc_cpu_version" in
+ 523) HP_ARCH=hppa1.0 ;; # CPU_PA_RISC1_0
+ 528) HP_ARCH=hppa1.1 ;; # CPU_PA_RISC1_1
+ 532) # CPU_PA_RISC2_0
+ case "$sc_kernel_bits" in
+ 32) HP_ARCH=hppa2.0n ;;
+ 64) HP_ARCH=hppa2.0w ;;
+ '') HP_ARCH=hppa2.0 ;; # HP-UX 10.20
+ esac ;;
+ esac
+ fi
+ if test "$HP_ARCH" = ""; then
+ set_cc_for_build
+ sed 's/^ //' << EOF > "$dummy.c"
+
+ #define _HPUX_SOURCE
+ #include
+ #include
+
+ int main ()
+ {
+ #if defined(_SC_KERNEL_BITS)
+ long bits = sysconf(_SC_KERNEL_BITS);
+ #endif
+ long cpu = sysconf (_SC_CPU_VERSION);
+
+ switch (cpu)
+ {
+ case CPU_PA_RISC1_0: puts ("hppa1.0"); break;
+ case CPU_PA_RISC1_1: puts ("hppa1.1"); break;
+ case CPU_PA_RISC2_0:
+ #if defined(_SC_KERNEL_BITS)
+ switch (bits)
+ {
+ case 64: puts ("hppa2.0w"); break;
+ case 32: puts ("hppa2.0n"); break;
+ default: puts ("hppa2.0"); break;
+ } break;
+ #else /* !defined(_SC_KERNEL_BITS) */
+ puts ("hppa2.0"); break;
+ #endif
+ default: puts ("hppa1.0"); break;
+ }
+ exit (0);
+ }
+EOF
+ (CCOPTS="" $CC_FOR_BUILD -o "$dummy" "$dummy.c" 2>/dev/null) && HP_ARCH=$("$dummy")
+ test -z "$HP_ARCH" && HP_ARCH=hppa
+ fi ;;
+ esac
+ if test "$HP_ARCH" = hppa2.0w
+ then
+ set_cc_for_build
+
+ # hppa2.0w-hp-hpux* has a 64-bit kernel and a compiler generating
+ # 32-bit code. hppa64-hp-hpux* has the same kernel and a compiler
+ # generating 64-bit code. GNU and HP use different nomenclature:
+ #
+ # $ CC_FOR_BUILD=cc ./config.guess
+ # => hppa2.0w-hp-hpux11.23
+ # $ CC_FOR_BUILD="cc +DA2.0w" ./config.guess
+ # => hppa64-hp-hpux11.23
+
+ if echo __LP64__ | (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) |
+ grep -q __LP64__
+ then
+ HP_ARCH=hppa2.0w
+ else
+ HP_ARCH=hppa64
+ fi
+ fi
+ echo "$HP_ARCH"-hp-hpux"$HPUX_REV"
+ exit ;;
+ ia64:HP-UX:*:*)
+ HPUX_REV=$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*.[0B]*//')
+ echo ia64-hp-hpux"$HPUX_REV"
+ exit ;;
+ 3050*:HI-UX:*:*)
+ set_cc_for_build
+ sed 's/^ //' << EOF > "$dummy.c"
+ #include
+ int
+ main ()
+ {
+ long cpu = sysconf (_SC_CPU_VERSION);
+ /* The order matters, because CPU_IS_HP_MC68K erroneously returns
+ true for CPU_PA_RISC1_0. CPU_IS_PA_RISC returns correct
+ results, however. */
+ if (CPU_IS_PA_RISC (cpu))
+ {
+ switch (cpu)
+ {
+ case CPU_PA_RISC1_0: puts ("hppa1.0-hitachi-hiuxwe2"); break;
+ case CPU_PA_RISC1_1: puts ("hppa1.1-hitachi-hiuxwe2"); break;
+ case CPU_PA_RISC2_0: puts ("hppa2.0-hitachi-hiuxwe2"); break;
+ default: puts ("hppa-hitachi-hiuxwe2"); break;
+ }
+ }
+ else if (CPU_IS_HP_MC68K (cpu))
+ puts ("m68k-hitachi-hiuxwe2");
+ else puts ("unknown-hitachi-hiuxwe2");
+ exit (0);
+ }
+EOF
+ $CC_FOR_BUILD -o "$dummy" "$dummy.c" && SYSTEM_NAME=$("$dummy") &&
+ { echo "$SYSTEM_NAME"; exit; }
+ echo unknown-hitachi-hiuxwe2
+ exit ;;
+ 9000/7??:4.3bsd:*:* | 9000/8?[79]:4.3bsd:*:*)
+ echo hppa1.1-hp-bsd
+ exit ;;
+ 9000/8??:4.3bsd:*:*)
+ echo hppa1.0-hp-bsd
+ exit ;;
+ *9??*:MPE/iX:*:* | *3000*:MPE/iX:*:*)
+ echo hppa1.0-hp-mpeix
+ exit ;;
+ hp7??:OSF1:*:* | hp8?[79]:OSF1:*:*)
+ echo hppa1.1-hp-osf
+ exit ;;
+ hp8??:OSF1:*:*)
+ echo hppa1.0-hp-osf
+ exit ;;
+ i*86:OSF1:*:*)
+ if test -x /usr/sbin/sysversion ; then
+ echo "$UNAME_MACHINE"-unknown-osf1mk
+ else
+ echo "$UNAME_MACHINE"-unknown-osf1
+ fi
+ exit ;;
+ parisc*:Lites*:*:*)
+ echo hppa1.1-hp-lites
+ exit ;;
+ C1*:ConvexOS:*:* | convex:ConvexOS:C1*:*)
+ echo c1-convex-bsd
+ exit ;;
+ C2*:ConvexOS:*:* | convex:ConvexOS:C2*:*)
+ if getsysinfo -f scalar_acc
+ then echo c32-convex-bsd
+ else echo c2-convex-bsd
+ fi
+ exit ;;
+ C34*:ConvexOS:*:* | convex:ConvexOS:C34*:*)
+ echo c34-convex-bsd
+ exit ;;
+ C38*:ConvexOS:*:* | convex:ConvexOS:C38*:*)
+ echo c38-convex-bsd
+ exit ;;
+ C4*:ConvexOS:*:* | convex:ConvexOS:C4*:*)
+ echo c4-convex-bsd
+ exit ;;
+ CRAY*Y-MP:*:*:*)
+ echo ymp-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/'
+ exit ;;
+ CRAY*[A-Z]90:*:*:*)
+ echo "$UNAME_MACHINE"-cray-unicos"$UNAME_RELEASE" \
+ | sed -e 's/CRAY.*\([A-Z]90\)/\1/' \
+ -e y/ABCDEFGHIJKLMNOPQRSTUVWXYZ/abcdefghijklmnopqrstuvwxyz/ \
+ -e 's/\.[^.]*$/.X/'
+ exit ;;
+ CRAY*TS:*:*:*)
+ echo t90-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/'
+ exit ;;
+ CRAY*T3E:*:*:*)
+ echo alphaev5-cray-unicosmk"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/'
+ exit ;;
+ CRAY*SV1:*:*:*)
+ echo sv1-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/'
+ exit ;;
+ *:UNICOS/mp:*:*)
+ echo craynv-cray-unicosmp"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/'
+ exit ;;
+ F30[01]:UNIX_System_V:*:* | F700:UNIX_System_V:*:*)
+ FUJITSU_PROC=$(uname -m | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz)
+ FUJITSU_SYS=$(uname -p | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/\///')
+ FUJITSU_REL=$(echo "$UNAME_RELEASE" | sed -e 's/ /_/')
+ echo "${FUJITSU_PROC}-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}"
+ exit ;;
+ 5000:UNIX_System_V:4.*:*)
+ FUJITSU_SYS=$(uname -p | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/\///')
+ FUJITSU_REL=$(echo "$UNAME_RELEASE" | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/ /_/')
+ echo "sparc-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}"
+ exit ;;
+ i*86:BSD/386:*:* | i*86:BSD/OS:*:* | *:Ascend\ Embedded/OS:*:*)
+ echo "$UNAME_MACHINE"-pc-bsdi"$UNAME_RELEASE"
+ exit ;;
+ sparc*:BSD/OS:*:*)
+ echo sparc-unknown-bsdi"$UNAME_RELEASE"
+ exit ;;
+ *:BSD/OS:*:*)
+ echo "$UNAME_MACHINE"-unknown-bsdi"$UNAME_RELEASE"
+ exit ;;
+ arm:FreeBSD:*:*)
+ UNAME_PROCESSOR=$(uname -p)
+ set_cc_for_build
+ if echo __ARM_PCS_VFP | $CC_FOR_BUILD -E - 2>/dev/null \
+ | grep -q __ARM_PCS_VFP
+ then
+ echo "${UNAME_PROCESSOR}"-unknown-freebsd"$(echo ${UNAME_RELEASE}|sed -e 's/[-(].*//')"-gnueabi
+ else
+ echo "${UNAME_PROCESSOR}"-unknown-freebsd"$(echo ${UNAME_RELEASE}|sed -e 's/[-(].*//')"-gnueabihf
+ fi
+ exit ;;
+ *:FreeBSD:*:*)
+ UNAME_PROCESSOR=$(/usr/bin/uname -p)
+ case "$UNAME_PROCESSOR" in
+ amd64)
+ UNAME_PROCESSOR=x86_64 ;;
+ i386)
+ UNAME_PROCESSOR=i586 ;;
+ esac
+ echo "$UNAME_PROCESSOR"-unknown-freebsd"$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')"
+ exit ;;
+ i*:CYGWIN*:*)
+ echo "$UNAME_MACHINE"-pc-cygwin
+ exit ;;
+ *:MINGW64*:*)
+ echo "$UNAME_MACHINE"-pc-mingw64
+ exit ;;
+ *:MINGW*:*)
+ echo "$UNAME_MACHINE"-pc-mingw32
+ exit ;;
+ *:MSYS*:*)
+ echo "$UNAME_MACHINE"-pc-msys
+ exit ;;
+ i*:PW*:*)
+ echo "$UNAME_MACHINE"-pc-pw32
+ exit ;;
+ *:Interix*:*)
+ case "$UNAME_MACHINE" in
+ x86)
+ echo i586-pc-interix"$UNAME_RELEASE"
+ exit ;;
+ authenticamd | genuineintel | EM64T)
+ echo x86_64-unknown-interix"$UNAME_RELEASE"
+ exit ;;
+ IA64)
+ echo ia64-unknown-interix"$UNAME_RELEASE"
+ exit ;;
+ esac ;;
+ i*:UWIN*:*)
+ echo "$UNAME_MACHINE"-pc-uwin
+ exit ;;
+ amd64:CYGWIN*:*:* | x86_64:CYGWIN*:*:*)
+ echo x86_64-pc-cygwin
+ exit ;;
+ prep*:SunOS:5.*:*)
+ echo powerpcle-unknown-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')"
+ exit ;;
+ *:GNU:*:*)
+ # the GNU system
+ echo "$(echo "$UNAME_MACHINE"|sed -e 's,[-/].*$,,')-unknown-$LIBC$(echo "$UNAME_RELEASE"|sed -e 's,/.*$,,')"
+ exit ;;
+ *:GNU/*:*:*)
+ # other systems with GNU libc and userland
+ echo "$UNAME_MACHINE-unknown-$(echo "$UNAME_SYSTEM" | sed 's,^[^/]*/,,' | tr "[:upper:]" "[:lower:]")$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')-$LIBC"
+ exit ;;
+ *:Minix:*:*)
+ echo "$UNAME_MACHINE"-unknown-minix
+ exit ;;
+ aarch64:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ aarch64_be:Linux:*:*)
+ UNAME_MACHINE=aarch64_be
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ alpha:Linux:*:*)
+ case $(sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' /proc/cpuinfo 2>/dev/null) in
+ EV5) UNAME_MACHINE=alphaev5 ;;
+ EV56) UNAME_MACHINE=alphaev56 ;;
+ PCA56) UNAME_MACHINE=alphapca56 ;;
+ PCA57) UNAME_MACHINE=alphapca56 ;;
+ EV6) UNAME_MACHINE=alphaev6 ;;
+ EV67) UNAME_MACHINE=alphaev67 ;;
+ EV68*) UNAME_MACHINE=alphaev68 ;;
+ esac
+ objdump --private-headers /bin/sh | grep -q ld.so.1
+ if test "$?" = 0 ; then LIBC=gnulibc1 ; fi
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ arc:Linux:*:* | arceb:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ arm*:Linux:*:*)
+ set_cc_for_build
+ if echo __ARM_EABI__ | $CC_FOR_BUILD -E - 2>/dev/null \
+ | grep -q __ARM_EABI__
+ then
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ else
+ if echo __ARM_PCS_VFP | $CC_FOR_BUILD -E - 2>/dev/null \
+ | grep -q __ARM_PCS_VFP
+ then
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"eabi
+ else
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"eabihf
+ fi
+ fi
+ exit ;;
+ avr32*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ cris:Linux:*:*)
+ echo "$UNAME_MACHINE"-axis-linux-"$LIBC"
+ exit ;;
+ crisv32:Linux:*:*)
+ echo "$UNAME_MACHINE"-axis-linux-"$LIBC"
+ exit ;;
+ e2k:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ frv:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ hexagon:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ i*86:Linux:*:*)
+ echo "$UNAME_MACHINE"-pc-linux-"$LIBC"
+ exit ;;
+ ia64:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ k1om:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ loongarch32:Linux:*:* | loongarch64:Linux:*:* | loongarchx32:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ m32r*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ m68*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ mips:Linux:*:* | mips64:Linux:*:*)
+ set_cc_for_build
+ IS_GLIBC=0
+ test x"${LIBC}" = xgnu && IS_GLIBC=1
+ sed 's/^ //' << EOF > "$dummy.c"
+ #undef CPU
+ #undef mips
+ #undef mipsel
+ #undef mips64
+ #undef mips64el
+ #if ${IS_GLIBC} && defined(_ABI64)
+ LIBCABI=gnuabi64
+ #else
+ #if ${IS_GLIBC} && defined(_ABIN32)
+ LIBCABI=gnuabin32
+ #else
+ LIBCABI=${LIBC}
+ #endif
+ #endif
+
+ #if ${IS_GLIBC} && defined(__mips64) && defined(__mips_isa_rev) && __mips_isa_rev>=6
+ CPU=mipsisa64r6
+ #else
+ #if ${IS_GLIBC} && !defined(__mips64) && defined(__mips_isa_rev) && __mips_isa_rev>=6
+ CPU=mipsisa32r6
+ #else
+ #if defined(__mips64)
+ CPU=mips64
+ #else
+ CPU=mips
+ #endif
+ #endif
+ #endif
+
+ #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL)
+ MIPS_ENDIAN=el
+ #else
+ #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB)
+ MIPS_ENDIAN=
+ #else
+ MIPS_ENDIAN=
+ #endif
+ #endif
+EOF
+ eval "$($CC_FOR_BUILD -E "$dummy.c" 2>/dev/null | grep '^CPU\|^MIPS_ENDIAN\|^LIBCABI')"
+ test "x$CPU" != x && { echo "$CPU${MIPS_ENDIAN}-unknown-linux-$LIBCABI"; exit; }
+ ;;
+ mips64el:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ openrisc*:Linux:*:*)
+ echo or1k-unknown-linux-"$LIBC"
+ exit ;;
+ or32:Linux:*:* | or1k*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ padre:Linux:*:*)
+ echo sparc-unknown-linux-"$LIBC"
+ exit ;;
+ parisc64:Linux:*:* | hppa64:Linux:*:*)
+ echo hppa64-unknown-linux-"$LIBC"
+ exit ;;
+ parisc:Linux:*:* | hppa:Linux:*:*)
+ # Look for CPU level
+ case $(grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2) in
+ PA7*) echo hppa1.1-unknown-linux-"$LIBC" ;;
+ PA8*) echo hppa2.0-unknown-linux-"$LIBC" ;;
+ *) echo hppa-unknown-linux-"$LIBC" ;;
+ esac
+ exit ;;
+ ppc64:Linux:*:*)
+ echo powerpc64-unknown-linux-"$LIBC"
+ exit ;;
+ ppc:Linux:*:*)
+ echo powerpc-unknown-linux-"$LIBC"
+ exit ;;
+ ppc64le:Linux:*:*)
+ echo powerpc64le-unknown-linux-"$LIBC"
+ exit ;;
+ ppcle:Linux:*:*)
+ echo powerpcle-unknown-linux-"$LIBC"
+ exit ;;
+ riscv32:Linux:*:* | riscv32be:Linux:*:* | riscv64:Linux:*:* | riscv64be:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ s390:Linux:*:* | s390x:Linux:*:*)
+ echo "$UNAME_MACHINE"-ibm-linux-"$LIBC"
+ exit ;;
+ sh64*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ sh*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ sparc:Linux:*:* | sparc64:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ tile*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ vax:Linux:*:*)
+ echo "$UNAME_MACHINE"-dec-linux-"$LIBC"
+ exit ;;
+ x86_64:Linux:*:*)
+ set_cc_for_build
+ LIBCABI=$LIBC
+ if test "$CC_FOR_BUILD" != no_compiler_found; then
+ if (echo '#ifdef __ILP32__'; echo IS_X32; echo '#endif') | \
+ (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \
+ grep IS_X32 >/dev/null
+ then
+ LIBCABI="$LIBC"x32
+ fi
+ fi
+ echo "$UNAME_MACHINE"-pc-linux-"$LIBCABI"
+ exit ;;
+ xtensa*:Linux:*:*)
+ echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"
+ exit ;;
+ i*86:DYNIX/ptx:4*:*)
+ # ptx 4.0 does uname -s correctly, with DYNIX/ptx in there.
+ # earlier versions are messed up and put the nodename in both
+ # sysname and nodename.
+ echo i386-sequent-sysv4
+ exit ;;
+ i*86:UNIX_SV:4.2MP:2.*)
+ # Unixware is an offshoot of SVR4, but it has its own version
+ # number series starting with 2...
+ # I am not positive that other SVR4 systems won't match this,
+ # I just have to hope. -- rms.
+ # Use sysv4.2uw... so that sysv4* matches it.
+ echo "$UNAME_MACHINE"-pc-sysv4.2uw"$UNAME_VERSION"
+ exit ;;
+ i*86:OS/2:*:*)
+ # If we were able to find `uname', then EMX Unix compatibility
+ # is probably installed.
+ echo "$UNAME_MACHINE"-pc-os2-emx
+ exit ;;
+ i*86:XTS-300:*:STOP)
+ echo "$UNAME_MACHINE"-unknown-stop
+ exit ;;
+ i*86:atheos:*:*)
+ echo "$UNAME_MACHINE"-unknown-atheos
+ exit ;;
+ i*86:syllable:*:*)
+ echo "$UNAME_MACHINE"-pc-syllable
+ exit ;;
+ i*86:LynxOS:2.*:* | i*86:LynxOS:3.[01]*:* | i*86:LynxOS:4.[02]*:*)
+ echo i386-unknown-lynxos"$UNAME_RELEASE"
+ exit ;;
+ i*86:*DOS:*:*)
+ echo "$UNAME_MACHINE"-pc-msdosdjgpp
+ exit ;;
+ i*86:*:4.*:*)
+ UNAME_REL=$(echo "$UNAME_RELEASE" | sed 's/\/MP$//')
+ if grep Novell /usr/include/link.h >/dev/null 2>/dev/null; then
+ echo "$UNAME_MACHINE"-univel-sysv"$UNAME_REL"
+ else
+ echo "$UNAME_MACHINE"-pc-sysv"$UNAME_REL"
+ fi
+ exit ;;
+ i*86:*:5:[678]*)
+ # UnixWare 7.x, OpenUNIX and OpenServer 6.
+ case $(/bin/uname -X | grep "^Machine") in
+ *486*) UNAME_MACHINE=i486 ;;
+ *Pentium) UNAME_MACHINE=i586 ;;
+ *Pent*|*Celeron) UNAME_MACHINE=i686 ;;
+ esac
+ echo "$UNAME_MACHINE-unknown-sysv${UNAME_RELEASE}${UNAME_SYSTEM}${UNAME_VERSION}"
+ exit ;;
+ i*86:*:3.2:*)
+ if test -f /usr/options/cb.name; then
+ UNAME_REL=$(sed -n 's/.*Version //p' /dev/null >/dev/null ; then
+ UNAME_REL=$( (/bin/uname -X|grep Release|sed -e 's/.*= //'))
+ (/bin/uname -X|grep i80486 >/dev/null) && UNAME_MACHINE=i486
+ (/bin/uname -X|grep '^Machine.*Pentium' >/dev/null) \
+ && UNAME_MACHINE=i586
+ (/bin/uname -X|grep '^Machine.*Pent *II' >/dev/null) \
+ && UNAME_MACHINE=i686
+ (/bin/uname -X|grep '^Machine.*Pentium Pro' >/dev/null) \
+ && UNAME_MACHINE=i686
+ echo "$UNAME_MACHINE"-pc-sco"$UNAME_REL"
+ else
+ echo "$UNAME_MACHINE"-pc-sysv32
+ fi
+ exit ;;
+ pc:*:*:*)
+ # Left here for compatibility:
+ # uname -m prints for DJGPP always 'pc', but it prints nothing about
+ # the processor, so we play safe by assuming i586.
+ # Note: whatever this is, it MUST be the same as what config.sub
+ # prints for the "djgpp" host, or else GDB configure will decide that
+ # this is a cross-build.
+ echo i586-pc-msdosdjgpp
+ exit ;;
+ Intel:Mach:3*:*)
+ echo i386-pc-mach3
+ exit ;;
+ paragon:*:*:*)
+ echo i860-intel-osf1
+ exit ;;
+ i860:*:4.*:*) # i860-SVR4
+ if grep Stardent /usr/include/sys/uadmin.h >/dev/null 2>&1 ; then
+ echo i860-stardent-sysv"$UNAME_RELEASE" # Stardent Vistra i860-SVR4
+ else # Add other i860-SVR4 vendors below as they are discovered.
+ echo i860-unknown-sysv"$UNAME_RELEASE" # Unknown i860-SVR4
+ fi
+ exit ;;
+ mini*:CTIX:SYS*5:*)
+ # "miniframe"
+ echo m68010-convergent-sysv
+ exit ;;
+ mc68k:UNIX:SYSTEM5:3.51m)
+ echo m68k-convergent-sysv
+ exit ;;
+ M680?0:D-NIX:5.3:*)
+ echo m68k-diab-dnix
+ exit ;;
+ M68*:*:R3V[5678]*:*)
+ test -r /sysV68 && { echo 'm68k-motorola-sysv'; exit; } ;;
+ 3[345]??:*:4.0:3.0 | 3[34]??A:*:4.0:3.0 | 3[34]??,*:*:4.0:3.0 | 3[34]??/*:*:4.0:3.0 | 4400:*:4.0:3.0 | 4850:*:4.0:3.0 | SKA40:*:4.0:3.0 | SDS2:*:4.0:3.0 | SHG2:*:4.0:3.0 | S7501*:*:4.0:3.0)
+ OS_REL=''
+ test -r /etc/.relid \
+ && OS_REL=.$(sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid)
+ /bin/uname -p 2>/dev/null | grep 86 >/dev/null \
+ && { echo i486-ncr-sysv4.3"$OS_REL"; exit; }
+ /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \
+ && { echo i586-ncr-sysv4.3"$OS_REL"; exit; } ;;
+ 3[34]??:*:4.0:* | 3[34]??,*:*:4.0:*)
+ /bin/uname -p 2>/dev/null | grep 86 >/dev/null \
+ && { echo i486-ncr-sysv4; exit; } ;;
+ NCR*:*:4.2:* | MPRAS*:*:4.2:*)
+ OS_REL='.3'
+ test -r /etc/.relid \
+ && OS_REL=.$(sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid)
+ /bin/uname -p 2>/dev/null | grep 86 >/dev/null \
+ && { echo i486-ncr-sysv4.3"$OS_REL"; exit; }
+ /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \
+ && { echo i586-ncr-sysv4.3"$OS_REL"; exit; }
+ /bin/uname -p 2>/dev/null | /bin/grep pteron >/dev/null \
+ && { echo i586-ncr-sysv4.3"$OS_REL"; exit; } ;;
+ m68*:LynxOS:2.*:* | m68*:LynxOS:3.0*:*)
+ echo m68k-unknown-lynxos"$UNAME_RELEASE"
+ exit ;;
+ mc68030:UNIX_System_V:4.*:*)
+ echo m68k-atari-sysv4
+ exit ;;
+ TSUNAMI:LynxOS:2.*:*)
+ echo sparc-unknown-lynxos"$UNAME_RELEASE"
+ exit ;;
+ rs6000:LynxOS:2.*:*)
+ echo rs6000-unknown-lynxos"$UNAME_RELEASE"
+ exit ;;
+ PowerPC:LynxOS:2.*:* | PowerPC:LynxOS:3.[01]*:* | PowerPC:LynxOS:4.[02]*:*)
+ echo powerpc-unknown-lynxos"$UNAME_RELEASE"
+ exit ;;
+ SM[BE]S:UNIX_SV:*:*)
+ echo mips-dde-sysv"$UNAME_RELEASE"
+ exit ;;
+ RM*:ReliantUNIX-*:*:*)
+ echo mips-sni-sysv4
+ exit ;;
+ RM*:SINIX-*:*:*)
+ echo mips-sni-sysv4
+ exit ;;
+ *:SINIX-*:*:*)
+ if uname -p 2>/dev/null >/dev/null ; then
+ UNAME_MACHINE=$( (uname -p) 2>/dev/null)
+ echo "$UNAME_MACHINE"-sni-sysv4
+ else
+ echo ns32k-sni-sysv
+ fi
+ exit ;;
+ PENTIUM:*:4.0*:*) # Unisys `ClearPath HMP IX 4000' SVR4/MP effort
+ # says
+ echo i586-unisys-sysv4
+ exit ;;
+ *:UNIX_System_V:4*:FTX*)
+ # From Gerald Hewes .
+ # How about differentiating between stratus architectures? -djm
+ echo hppa1.1-stratus-sysv4
+ exit ;;
+ *:*:*:FTX*)
+ # From seanf@swdc.stratus.com.
+ echo i860-stratus-sysv4
+ exit ;;
+ i*86:VOS:*:*)
+ # From Paul.Green@stratus.com.
+ echo "$UNAME_MACHINE"-stratus-vos
+ exit ;;
+ *:VOS:*:*)
+ # From Paul.Green@stratus.com.
+ echo hppa1.1-stratus-vos
+ exit ;;
+ mc68*:A/UX:*:*)
+ echo m68k-apple-aux"$UNAME_RELEASE"
+ exit ;;
+ news*:NEWS-OS:6*:*)
+ echo mips-sony-newsos6
+ exit ;;
+ R[34]000:*System_V*:*:* | R4000:UNIX_SYSV:*:* | R*000:UNIX_SV:*:*)
+ if test -d /usr/nec; then
+ echo mips-nec-sysv"$UNAME_RELEASE"
+ else
+ echo mips-unknown-sysv"$UNAME_RELEASE"
+ fi
+ exit ;;
+ BeBox:BeOS:*:*) # BeOS running on hardware made by Be, PPC only.
+ echo powerpc-be-beos
+ exit ;;
+ BeMac:BeOS:*:*) # BeOS running on Mac or Mac clone, PPC only.
+ echo powerpc-apple-beos
+ exit ;;
+ BePC:BeOS:*:*) # BeOS running on Intel PC compatible.
+ echo i586-pc-beos
+ exit ;;
+ BePC:Haiku:*:*) # Haiku running on Intel PC compatible.
+ echo i586-pc-haiku
+ exit ;;
+ x86_64:Haiku:*:*)
+ echo x86_64-unknown-haiku
+ exit ;;
+ SX-4:SUPER-UX:*:*)
+ echo sx4-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-5:SUPER-UX:*:*)
+ echo sx5-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-6:SUPER-UX:*:*)
+ echo sx6-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-7:SUPER-UX:*:*)
+ echo sx7-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-8:SUPER-UX:*:*)
+ echo sx8-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-8R:SUPER-UX:*:*)
+ echo sx8r-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ SX-ACE:SUPER-UX:*:*)
+ echo sxace-nec-superux"$UNAME_RELEASE"
+ exit ;;
+ Power*:Rhapsody:*:*)
+ echo powerpc-apple-rhapsody"$UNAME_RELEASE"
+ exit ;;
+ *:Rhapsody:*:*)
+ echo "$UNAME_MACHINE"-apple-rhapsody"$UNAME_RELEASE"
+ exit ;;
+ arm64:Darwin:*:*)
+ echo aarch64-apple-darwin"$UNAME_RELEASE"
+ exit ;;
+ *:Darwin:*:*)
+ UNAME_PROCESSOR=$(uname -p)
+ case $UNAME_PROCESSOR in
+ unknown) UNAME_PROCESSOR=powerpc ;;
+ esac
+ if command -v xcode-select > /dev/null 2> /dev/null && \
+ ! xcode-select --print-path > /dev/null 2> /dev/null ; then
+ # Avoid executing cc if there is no toolchain installed as
+ # cc will be a stub that puts up a graphical alert
+ # prompting the user to install developer tools.
+ CC_FOR_BUILD=no_compiler_found
+ else
+ set_cc_for_build
+ fi
+ if test "$CC_FOR_BUILD" != no_compiler_found; then
+ if (echo '#ifdef __LP64__'; echo IS_64BIT_ARCH; echo '#endif') | \
+ (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \
+ grep IS_64BIT_ARCH >/dev/null
+ then
+ case $UNAME_PROCESSOR in
+ i386) UNAME_PROCESSOR=x86_64 ;;
+ powerpc) UNAME_PROCESSOR=powerpc64 ;;
+ esac
+ fi
+ # On 10.4-10.6 one might compile for PowerPC via gcc -arch ppc
+ if (echo '#ifdef __POWERPC__'; echo IS_PPC; echo '#endif') | \
+ (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \
+ grep IS_PPC >/dev/null
+ then
+ UNAME_PROCESSOR=powerpc
+ fi
+ elif test "$UNAME_PROCESSOR" = i386 ; then
+ # uname -m returns i386 or x86_64
+ UNAME_PROCESSOR=$UNAME_MACHINE
+ fi
+ echo "$UNAME_PROCESSOR"-apple-darwin"$UNAME_RELEASE"
+ exit ;;
+ *:procnto*:*:* | *:QNX:[0123456789]*:*)
+ UNAME_PROCESSOR=$(uname -p)
+ if test "$UNAME_PROCESSOR" = x86; then
+ UNAME_PROCESSOR=i386
+ UNAME_MACHINE=pc
+ fi
+ echo "$UNAME_PROCESSOR"-"$UNAME_MACHINE"-nto-qnx"$UNAME_RELEASE"
+ exit ;;
+ *:QNX:*:4*)
+ echo i386-pc-qnx
+ exit ;;
+ NEO-*:NONSTOP_KERNEL:*:*)
+ echo neo-tandem-nsk"$UNAME_RELEASE"
+ exit ;;
+ NSE-*:NONSTOP_KERNEL:*:*)
+ echo nse-tandem-nsk"$UNAME_RELEASE"
+ exit ;;
+ NSR-*:NONSTOP_KERNEL:*:*)
+ echo nsr-tandem-nsk"$UNAME_RELEASE"
+ exit ;;
+ NSV-*:NONSTOP_KERNEL:*:*)
+ echo nsv-tandem-nsk"$UNAME_RELEASE"
+ exit ;;
+ NSX-*:NONSTOP_KERNEL:*:*)
+ echo nsx-tandem-nsk"$UNAME_RELEASE"
+ exit ;;
+ *:NonStop-UX:*:*)
+ echo mips-compaq-nonstopux
+ exit ;;
+ BS2000:POSIX*:*:*)
+ echo bs2000-siemens-sysv
+ exit ;;
+ DS/*:UNIX_System_V:*:*)
+ echo "$UNAME_MACHINE"-"$UNAME_SYSTEM"-"$UNAME_RELEASE"
+ exit ;;
+ *:Plan9:*:*)
+ # "uname -m" is not consistent, so use $cputype instead. 386
+ # is converted to i386 for consistency with other x86
+ # operating systems.
+ # shellcheck disable=SC2154
+ if test "$cputype" = 386; then
+ UNAME_MACHINE=i386
+ else
+ UNAME_MACHINE="$cputype"
+ fi
+ echo "$UNAME_MACHINE"-unknown-plan9
+ exit ;;
+ *:TOPS-10:*:*)
+ echo pdp10-unknown-tops10
+ exit ;;
+ *:TENEX:*:*)
+ echo pdp10-unknown-tenex
+ exit ;;
+ KS10:TOPS-20:*:* | KL10:TOPS-20:*:* | TYPE4:TOPS-20:*:*)
+ echo pdp10-dec-tops20
+ exit ;;
+ XKL-1:TOPS-20:*:* | TYPE5:TOPS-20:*:*)
+ echo pdp10-xkl-tops20
+ exit ;;
+ *:TOPS-20:*:*)
+ echo pdp10-unknown-tops20
+ exit ;;
+ *:ITS:*:*)
+ echo pdp10-unknown-its
+ exit ;;
+ SEI:*:*:SEIUX)
+ echo mips-sei-seiux"$UNAME_RELEASE"
+ exit ;;
+ *:DragonFly:*:*)
+ echo "$UNAME_MACHINE"-unknown-dragonfly"$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')"
+ exit ;;
+ *:*VMS:*:*)
+ UNAME_MACHINE=$( (uname -p) 2>/dev/null)
+ case "$UNAME_MACHINE" in
+ A*) echo alpha-dec-vms ; exit ;;
+ I*) echo ia64-dec-vms ; exit ;;
+ V*) echo vax-dec-vms ; exit ;;
+ esac ;;
+ *:XENIX:*:SysV)
+ echo i386-pc-xenix
+ exit ;;
+ i*86:skyos:*:*)
+ echo "$UNAME_MACHINE"-pc-skyos"$(echo "$UNAME_RELEASE" | sed -e 's/ .*$//')"
+ exit ;;
+ i*86:rdos:*:*)
+ echo "$UNAME_MACHINE"-pc-rdos
+ exit ;;
+ *:AROS:*:*)
+ echo "$UNAME_MACHINE"-unknown-aros
+ exit ;;
+ x86_64:VMkernel:*:*)
+ echo "$UNAME_MACHINE"-unknown-esx
+ exit ;;
+ amd64:Isilon\ OneFS:*:*)
+ echo x86_64-unknown-onefs
+ exit ;;
+ *:Unleashed:*:*)
+ echo "$UNAME_MACHINE"-unknown-unleashed"$UNAME_RELEASE"
+ exit ;;
+esac
+
+# No uname command or uname output not recognized.
+set_cc_for_build
+cat > "$dummy.c" <
+#include
+#endif
+#if defined(ultrix) || defined(_ultrix) || defined(__ultrix) || defined(__ultrix__)
+#if defined (vax) || defined (__vax) || defined (__vax__) || defined(mips) || defined(__mips) || defined(__mips__) || defined(MIPS) || defined(__MIPS__)
+#include
+#if defined(_SIZE_T_) || defined(SIGLOST)
+#include
+#endif
+#endif
+#endif
+main ()
+{
+#if defined (sony)
+#if defined (MIPSEB)
+ /* BFD wants "bsd" instead of "newsos". Perhaps BFD should be changed,
+ I don't know.... */
+ printf ("mips-sony-bsd\n"); exit (0);
+#else
+#include
+ printf ("m68k-sony-newsos%s\n",
+#ifdef NEWSOS4
+ "4"
+#else
+ ""
+#endif
+ ); exit (0);
+#endif
+#endif
+
+#if defined (NeXT)
+#if !defined (__ARCHITECTURE__)
+#define __ARCHITECTURE__ "m68k"
+#endif
+ int version;
+ version=$( (hostinfo | sed -n 's/.*NeXT Mach \([0-9]*\).*/\1/p') 2>/dev/null);
+ if (version < 4)
+ printf ("%s-next-nextstep%d\n", __ARCHITECTURE__, version);
+ else
+ printf ("%s-next-openstep%d\n", __ARCHITECTURE__, version);
+ exit (0);
+#endif
+
+#if defined (MULTIMAX) || defined (n16)
+#if defined (UMAXV)
+ printf ("ns32k-encore-sysv\n"); exit (0);
+#else
+#if defined (CMU)
+ printf ("ns32k-encore-mach\n"); exit (0);
+#else
+ printf ("ns32k-encore-bsd\n"); exit (0);
+#endif
+#endif
+#endif
+
+#if defined (__386BSD__)
+ printf ("i386-pc-bsd\n"); exit (0);
+#endif
+
+#if defined (sequent)
+#if defined (i386)
+ printf ("i386-sequent-dynix\n"); exit (0);
+#endif
+#if defined (ns32000)
+ printf ("ns32k-sequent-dynix\n"); exit (0);
+#endif
+#endif
+
+#if defined (_SEQUENT_)
+ struct utsname un;
+
+ uname(&un);
+ if (strncmp(un.version, "V2", 2) == 0) {
+ printf ("i386-sequent-ptx2\n"); exit (0);
+ }
+ if (strncmp(un.version, "V1", 2) == 0) { /* XXX is V1 correct? */
+ printf ("i386-sequent-ptx1\n"); exit (0);
+ }
+ printf ("i386-sequent-ptx\n"); exit (0);
+#endif
+
+#if defined (vax)
+#if !defined (ultrix)
+#include
+#if defined (BSD)
+#if BSD == 43
+ printf ("vax-dec-bsd4.3\n"); exit (0);
+#else
+#if BSD == 199006
+ printf ("vax-dec-bsd4.3reno\n"); exit (0);
+#else
+ printf ("vax-dec-bsd\n"); exit (0);
+#endif
+#endif
+#else
+ printf ("vax-dec-bsd\n"); exit (0);
+#endif
+#else
+#if defined(_SIZE_T_) || defined(SIGLOST)
+ struct utsname un;
+ uname (&un);
+ printf ("vax-dec-ultrix%s\n", un.release); exit (0);
+#else
+ printf ("vax-dec-ultrix\n"); exit (0);
+#endif
+#endif
+#endif
+#if defined(ultrix) || defined(_ultrix) || defined(__ultrix) || defined(__ultrix__)
+#if defined(mips) || defined(__mips) || defined(__mips__) || defined(MIPS) || defined(__MIPS__)
+#if defined(_SIZE_T_) || defined(SIGLOST)
+ struct utsname *un;
+ uname (&un);
+ printf ("mips-dec-ultrix%s\n", un.release); exit (0);
+#else
+ printf ("mips-dec-ultrix\n"); exit (0);
+#endif
+#endif
+#endif
+
+#if defined (alliant) && defined (i860)
+ printf ("i860-alliant-bsd\n"); exit (0);
+#endif
+
+ exit (1);
+}
+EOF
+
+$CC_FOR_BUILD -o "$dummy" "$dummy.c" 2>/dev/null && SYSTEM_NAME=$($dummy) &&
+ { echo "$SYSTEM_NAME"; exit; }
+
+# Apollos put the system type in the environment.
+test -d /usr/apollo && { echo "$ISP-apollo-$SYSTYPE"; exit; }
+
+echo "$0: unable to guess system type" >&2
+
+case "$UNAME_MACHINE:$UNAME_SYSTEM" in
+ mips:Linux | mips64:Linux)
+ # If we got here on MIPS GNU/Linux, output extra information.
+ cat >&2 <&2 <&2 </dev/null || echo unknown)
+uname -r = $( (uname -r) 2>/dev/null || echo unknown)
+uname -s = $( (uname -s) 2>/dev/null || echo unknown)
+uname -v = $( (uname -v) 2>/dev/null || echo unknown)
+
+/usr/bin/uname -p = $( (/usr/bin/uname -p) 2>/dev/null)
+/bin/uname -X = $( (/bin/uname -X) 2>/dev/null)
+
+hostinfo = $( (hostinfo) 2>/dev/null)
+/bin/universe = $( (/bin/universe) 2>/dev/null)
+/usr/bin/arch -k = $( (/usr/bin/arch -k) 2>/dev/null)
+/bin/arch = $( (/bin/arch) 2>/dev/null)
+/usr/bin/oslevel = $( (/usr/bin/oslevel) 2>/dev/null)
+/usr/convex/getsysinfo = $( (/usr/convex/getsysinfo) 2>/dev/null)
+
+UNAME_MACHINE = "$UNAME_MACHINE"
+UNAME_RELEASE = "$UNAME_RELEASE"
+UNAME_SYSTEM = "$UNAME_SYSTEM"
+UNAME_VERSION = "$UNAME_VERSION"
+EOF
+fi
+
+exit 1
+
+# Local variables:
+# eval: (add-hook 'before-save-hook 'time-stamp)
+# time-stamp-start: "timestamp='"
+# time-stamp-format: "%:y-%02m-%02d"
+# time-stamp-end: "'"
+# End:
diff --git a/build-aux/config.sub b/build-aux/config.sub
new file mode 100755
index 0000000..63c1f1c
--- /dev/null
+++ b/build-aux/config.sub
@@ -0,0 +1,1860 @@
+#! /bin/sh
+# Configuration validation subroutine script.
+# Copyright 1992-2021 Free Software Foundation, Inc.
+
+timestamp='2021-01-08'
+
+# This file is free software; you can redistribute it and/or modify it
+# under the terms of the GNU General Public License as published by
+# the Free Software Foundation; either version 3 of the License, or
+# (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful, but
+# WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+# General Public License for more details.
+#
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, see .
+#
+# As a special exception to the GNU General Public License, if you
+# distribute this file as part of a program that contains a
+# configuration script generated by Autoconf, you may include it under
+# the same distribution terms that you use for the rest of that
+# program. This Exception is an additional permission under section 7
+# of the GNU General Public License, version 3 ("GPLv3").
+
+
+# Please send patches to .
+#
+# Configuration subroutine to validate and canonicalize a configuration type.
+# Supply the specified configuration type as an argument.
+# If it is invalid, we print an error message on stderr and exit with code 1.
+# Otherwise, we print the canonical config type on stdout and succeed.
+
+# You can get the latest version of this script from:
+# https://git.savannah.gnu.org/cgit/config.git/plain/config.sub
+
+# This file is supposed to be the same for all GNU packages
+# and recognize all the CPU types, system types and aliases
+# that are meaningful with *any* GNU software.
+# Each package is responsible for reporting which valid configurations
+# it does not support. The user should be able to distinguish
+# a failure to support a valid configuration from a meaningless
+# configuration.
+
+# The goal of this file is to map all the various variations of a given
+# machine specification into a single specification in the form:
+# CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM
+# or in some cases, the newer four-part form:
+# CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM
+# It is wrong to echo any other type of specification.
+
+me=$(echo "$0" | sed -e 's,.*/,,')
+
+usage="\
+Usage: $0 [OPTION] CPU-MFR-OPSYS or ALIAS
+
+Canonicalize a configuration name.
+
+Options:
+ -h, --help print this help, then exit
+ -t, --time-stamp print date of last modification, then exit
+ -v, --version print version number, then exit
+
+Report bugs and patches to ."
+
+version="\
+GNU config.sub ($timestamp)
+
+Copyright 1992-2021 Free Software Foundation, Inc.
+
+This is free software; see the source for copying conditions. There is NO
+warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE."
+
+help="
+Try \`$me --help' for more information."
+
+# Parse command line
+while test $# -gt 0 ; do
+ case $1 in
+ --time-stamp | --time* | -t )
+ echo "$timestamp" ; exit ;;
+ --version | -v )
+ echo "$version" ; exit ;;
+ --help | --h* | -h )
+ echo "$usage"; exit ;;
+ -- ) # Stop option processing
+ shift; break ;;
+ - ) # Use stdin as input.
+ break ;;
+ -* )
+ echo "$me: invalid option $1$help" >&2
+ exit 1 ;;
+
+ *local*)
+ # First pass through any local machine types.
+ echo "$1"
+ exit ;;
+
+ * )
+ break ;;
+ esac
+done
+
+case $# in
+ 0) echo "$me: missing argument$help" >&2
+ exit 1;;
+ 1) ;;
+ *) echo "$me: too many arguments$help" >&2
+ exit 1;;
+esac
+
+# Split fields of configuration type
+# shellcheck disable=SC2162
+IFS="-" read field1 field2 field3 field4 <&2
+ exit 1
+ ;;
+ *-*-*-*)
+ basic_machine=$field1-$field2
+ basic_os=$field3-$field4
+ ;;
+ *-*-*)
+ # Ambiguous whether COMPANY is present, or skipped and KERNEL-OS is two
+ # parts
+ maybe_os=$field2-$field3
+ case $maybe_os in
+ nto-qnx* | linux-* | uclinux-uclibc* \
+ | uclinux-gnu* | kfreebsd*-gnu* | knetbsd*-gnu* | netbsd*-gnu* \
+ | netbsd*-eabi* | kopensolaris*-gnu* | cloudabi*-eabi* \
+ | storm-chaos* | os2-emx* | rtmk-nova*)
+ basic_machine=$field1
+ basic_os=$maybe_os
+ ;;
+ android-linux)
+ basic_machine=$field1-unknown
+ basic_os=linux-android
+ ;;
+ *)
+ basic_machine=$field1-$field2
+ basic_os=$field3
+ ;;
+ esac
+ ;;
+ *-*)
+ # A lone config we happen to match not fitting any pattern
+ case $field1-$field2 in
+ decstation-3100)
+ basic_machine=mips-dec
+ basic_os=
+ ;;
+ *-*)
+ # Second component is usually, but not always the OS
+ case $field2 in
+ # Prevent following clause from handling this valid os
+ sun*os*)
+ basic_machine=$field1
+ basic_os=$field2
+ ;;
+ # Manufacturers
+ dec* | mips* | sequent* | encore* | pc533* | sgi* | sony* \
+ | att* | 7300* | 3300* | delta* | motorola* | sun[234]* \
+ | unicom* | ibm* | next | hp | isi* | apollo | altos* \
+ | convergent* | ncr* | news | 32* | 3600* | 3100* \
+ | hitachi* | c[123]* | convex* | sun | crds | omron* | dg \
+ | ultra | tti* | harris | dolphin | highlevel | gould \
+ | cbm | ns | masscomp | apple | axis | knuth | cray \
+ | microblaze* | sim | cisco \
+ | oki | wec | wrs | winbond)
+ basic_machine=$field1-$field2
+ basic_os=
+ ;;
+ *)
+ basic_machine=$field1
+ basic_os=$field2
+ ;;
+ esac
+ ;;
+ esac
+ ;;
+ *)
+ # Convert single-component short-hands not valid as part of
+ # multi-component configurations.
+ case $field1 in
+ 386bsd)
+ basic_machine=i386-pc
+ basic_os=bsd
+ ;;
+ a29khif)
+ basic_machine=a29k-amd
+ basic_os=udi
+ ;;
+ adobe68k)
+ basic_machine=m68010-adobe
+ basic_os=scout
+ ;;
+ alliant)
+ basic_machine=fx80-alliant
+ basic_os=
+ ;;
+ altos | altos3068)
+ basic_machine=m68k-altos
+ basic_os=
+ ;;
+ am29k)
+ basic_machine=a29k-none
+ basic_os=bsd
+ ;;
+ amdahl)
+ basic_machine=580-amdahl
+ basic_os=sysv
+ ;;
+ amiga)
+ basic_machine=m68k-unknown
+ basic_os=
+ ;;
+ amigaos | amigados)
+ basic_machine=m68k-unknown
+ basic_os=amigaos
+ ;;
+ amigaunix | amix)
+ basic_machine=m68k-unknown
+ basic_os=sysv4
+ ;;
+ apollo68)
+ basic_machine=m68k-apollo
+ basic_os=sysv
+ ;;
+ apollo68bsd)
+ basic_machine=m68k-apollo
+ basic_os=bsd
+ ;;
+ aros)
+ basic_machine=i386-pc
+ basic_os=aros
+ ;;
+ aux)
+ basic_machine=m68k-apple
+ basic_os=aux
+ ;;
+ balance)
+ basic_machine=ns32k-sequent
+ basic_os=dynix
+ ;;
+ blackfin)
+ basic_machine=bfin-unknown
+ basic_os=linux
+ ;;
+ cegcc)
+ basic_machine=arm-unknown
+ basic_os=cegcc
+ ;;
+ convex-c1)
+ basic_machine=c1-convex
+ basic_os=bsd
+ ;;
+ convex-c2)
+ basic_machine=c2-convex
+ basic_os=bsd
+ ;;
+ convex-c32)
+ basic_machine=c32-convex
+ basic_os=bsd
+ ;;
+ convex-c34)
+ basic_machine=c34-convex
+ basic_os=bsd
+ ;;
+ convex-c38)
+ basic_machine=c38-convex
+ basic_os=bsd
+ ;;
+ cray)
+ basic_machine=j90-cray
+ basic_os=unicos
+ ;;
+ crds | unos)
+ basic_machine=m68k-crds
+ basic_os=
+ ;;
+ da30)
+ basic_machine=m68k-da30
+ basic_os=
+ ;;
+ decstation | pmax | pmin | dec3100 | decstatn)
+ basic_machine=mips-dec
+ basic_os=
+ ;;
+ delta88)
+ basic_machine=m88k-motorola
+ basic_os=sysv3
+ ;;
+ dicos)
+ basic_machine=i686-pc
+ basic_os=dicos
+ ;;
+ djgpp)
+ basic_machine=i586-pc
+ basic_os=msdosdjgpp
+ ;;
+ ebmon29k)
+ basic_machine=a29k-amd
+ basic_os=ebmon
+ ;;
+ es1800 | OSE68k | ose68k | ose | OSE)
+ basic_machine=m68k-ericsson
+ basic_os=ose
+ ;;
+ gmicro)
+ basic_machine=tron-gmicro
+ basic_os=sysv
+ ;;
+ go32)
+ basic_machine=i386-pc
+ basic_os=go32
+ ;;
+ h8300hms)
+ basic_machine=h8300-hitachi
+ basic_os=hms
+ ;;
+ h8300xray)
+ basic_machine=h8300-hitachi
+ basic_os=xray
+ ;;
+ h8500hms)
+ basic_machine=h8500-hitachi
+ basic_os=hms
+ ;;
+ harris)
+ basic_machine=m88k-harris
+ basic_os=sysv3
+ ;;
+ hp300 | hp300hpux)
+ basic_machine=m68k-hp
+ basic_os=hpux
+ ;;
+ hp300bsd)
+ basic_machine=m68k-hp
+ basic_os=bsd
+ ;;
+ hppaosf)
+ basic_machine=hppa1.1-hp
+ basic_os=osf
+ ;;
+ hppro)
+ basic_machine=hppa1.1-hp
+ basic_os=proelf
+ ;;
+ i386mach)
+ basic_machine=i386-mach
+ basic_os=mach
+ ;;
+ isi68 | isi)
+ basic_machine=m68k-isi
+ basic_os=sysv
+ ;;
+ m68knommu)
+ basic_machine=m68k-unknown
+ basic_os=linux
+ ;;
+ magnum | m3230)
+ basic_machine=mips-mips
+ basic_os=sysv
+ ;;
+ merlin)
+ basic_machine=ns32k-utek
+ basic_os=sysv
+ ;;
+ mingw64)
+ basic_machine=x86_64-pc
+ basic_os=mingw64
+ ;;
+ mingw32)
+ basic_machine=i686-pc
+ basic_os=mingw32
+ ;;
+ mingw32ce)
+ basic_machine=arm-unknown
+ basic_os=mingw32ce
+ ;;
+ monitor)
+ basic_machine=m68k-rom68k
+ basic_os=coff
+ ;;
+ morphos)
+ basic_machine=powerpc-unknown
+ basic_os=morphos
+ ;;
+ moxiebox)
+ basic_machine=moxie-unknown
+ basic_os=moxiebox
+ ;;
+ msdos)
+ basic_machine=i386-pc
+ basic_os=msdos
+ ;;
+ msys)
+ basic_machine=i686-pc
+ basic_os=msys
+ ;;
+ mvs)
+ basic_machine=i370-ibm
+ basic_os=mvs
+ ;;
+ nacl)
+ basic_machine=le32-unknown
+ basic_os=nacl
+ ;;
+ ncr3000)
+ basic_machine=i486-ncr
+ basic_os=sysv4
+ ;;
+ netbsd386)
+ basic_machine=i386-pc
+ basic_os=netbsd
+ ;;
+ netwinder)
+ basic_machine=armv4l-rebel
+ basic_os=linux
+ ;;
+ news | news700 | news800 | news900)
+ basic_machine=m68k-sony
+ basic_os=newsos
+ ;;
+ news1000)
+ basic_machine=m68030-sony
+ basic_os=newsos
+ ;;
+ necv70)
+ basic_machine=v70-nec
+ basic_os=sysv
+ ;;
+ nh3000)
+ basic_machine=m68k-harris
+ basic_os=cxux
+ ;;
+ nh[45]000)
+ basic_machine=m88k-harris
+ basic_os=cxux
+ ;;
+ nindy960)
+ basic_machine=i960-intel
+ basic_os=nindy
+ ;;
+ mon960)
+ basic_machine=i960-intel
+ basic_os=mon960
+ ;;
+ nonstopux)
+ basic_machine=mips-compaq
+ basic_os=nonstopux
+ ;;
+ os400)
+ basic_machine=powerpc-ibm
+ basic_os=os400
+ ;;
+ OSE68000 | ose68000)
+ basic_machine=m68000-ericsson
+ basic_os=ose
+ ;;
+ os68k)
+ basic_machine=m68k-none
+ basic_os=os68k
+ ;;
+ paragon)
+ basic_machine=i860-intel
+ basic_os=osf
+ ;;
+ parisc)
+ basic_machine=hppa-unknown
+ basic_os=linux
+ ;;
+ psp)
+ basic_machine=mipsallegrexel-sony
+ basic_os=psp
+ ;;
+ pw32)
+ basic_machine=i586-unknown
+ basic_os=pw32
+ ;;
+ rdos | rdos64)
+ basic_machine=x86_64-pc
+ basic_os=rdos
+ ;;
+ rdos32)
+ basic_machine=i386-pc
+ basic_os=rdos
+ ;;
+ rom68k)
+ basic_machine=m68k-rom68k
+ basic_os=coff
+ ;;
+ sa29200)
+ basic_machine=a29k-amd
+ basic_os=udi
+ ;;
+ sei)
+ basic_machine=mips-sei
+ basic_os=seiux
+ ;;
+ sequent)
+ basic_machine=i386-sequent
+ basic_os=
+ ;;
+ sps7)
+ basic_machine=m68k-bull
+ basic_os=sysv2
+ ;;
+ st2000)
+ basic_machine=m68k-tandem
+ basic_os=
+ ;;
+ stratus)
+ basic_machine=i860-stratus
+ basic_os=sysv4
+ ;;
+ sun2)
+ basic_machine=m68000-sun
+ basic_os=
+ ;;
+ sun2os3)
+ basic_machine=m68000-sun
+ basic_os=sunos3
+ ;;
+ sun2os4)
+ basic_machine=m68000-sun
+ basic_os=sunos4
+ ;;
+ sun3)
+ basic_machine=m68k-sun
+ basic_os=
+ ;;
+ sun3os3)
+ basic_machine=m68k-sun
+ basic_os=sunos3
+ ;;
+ sun3os4)
+ basic_machine=m68k-sun
+ basic_os=sunos4
+ ;;
+ sun4)
+ basic_machine=sparc-sun
+ basic_os=
+ ;;
+ sun4os3)
+ basic_machine=sparc-sun
+ basic_os=sunos3
+ ;;
+ sun4os4)
+ basic_machine=sparc-sun
+ basic_os=sunos4
+ ;;
+ sun4sol2)
+ basic_machine=sparc-sun
+ basic_os=solaris2
+ ;;
+ sun386 | sun386i | roadrunner)
+ basic_machine=i386-sun
+ basic_os=
+ ;;
+ sv1)
+ basic_machine=sv1-cray
+ basic_os=unicos
+ ;;
+ symmetry)
+ basic_machine=i386-sequent
+ basic_os=dynix
+ ;;
+ t3e)
+ basic_machine=alphaev5-cray
+ basic_os=unicos
+ ;;
+ t90)
+ basic_machine=t90-cray
+ basic_os=unicos
+ ;;
+ toad1)
+ basic_machine=pdp10-xkl
+ basic_os=tops20
+ ;;
+ tpf)
+ basic_machine=s390x-ibm
+ basic_os=tpf
+ ;;
+ udi29k)
+ basic_machine=a29k-amd
+ basic_os=udi
+ ;;
+ ultra3)
+ basic_machine=a29k-nyu
+ basic_os=sym1
+ ;;
+ v810 | necv810)
+ basic_machine=v810-nec
+ basic_os=none
+ ;;
+ vaxv)
+ basic_machine=vax-dec
+ basic_os=sysv
+ ;;
+ vms)
+ basic_machine=vax-dec
+ basic_os=vms
+ ;;
+ vsta)
+ basic_machine=i386-pc
+ basic_os=vsta
+ ;;
+ vxworks960)
+ basic_machine=i960-wrs
+ basic_os=vxworks
+ ;;
+ vxworks68)
+ basic_machine=m68k-wrs
+ basic_os=vxworks
+ ;;
+ vxworks29k)
+ basic_machine=a29k-wrs
+ basic_os=vxworks
+ ;;
+ xbox)
+ basic_machine=i686-pc
+ basic_os=mingw32
+ ;;
+ ymp)
+ basic_machine=ymp-cray
+ basic_os=unicos
+ ;;
+ *)
+ basic_machine=$1
+ basic_os=
+ ;;
+ esac
+ ;;
+esac
+
+# Decode 1-component or ad-hoc basic machines
+case $basic_machine in
+ # Here we handle the default manufacturer of certain CPU types. It is in
+ # some cases the only manufacturer, in others, it is the most popular.
+ w89k)
+ cpu=hppa1.1
+ vendor=winbond
+ ;;
+ op50n)
+ cpu=hppa1.1
+ vendor=oki
+ ;;
+ op60c)
+ cpu=hppa1.1
+ vendor=oki
+ ;;
+ ibm*)
+ cpu=i370
+ vendor=ibm
+ ;;
+ orion105)
+ cpu=clipper
+ vendor=highlevel
+ ;;
+ mac | mpw | mac-mpw)
+ cpu=m68k
+ vendor=apple
+ ;;
+ pmac | pmac-mpw)
+ cpu=powerpc
+ vendor=apple
+ ;;
+
+ # Recognize the various machine names and aliases which stand
+ # for a CPU type and a company and sometimes even an OS.
+ 3b1 | 7300 | 7300-att | att-7300 | pc7300 | safari | unixpc)
+ cpu=m68000
+ vendor=att
+ ;;
+ 3b*)
+ cpu=we32k
+ vendor=att
+ ;;
+ bluegene*)
+ cpu=powerpc
+ vendor=ibm
+ basic_os=cnk
+ ;;
+ decsystem10* | dec10*)
+ cpu=pdp10
+ vendor=dec
+ basic_os=tops10
+ ;;
+ decsystem20* | dec20*)
+ cpu=pdp10
+ vendor=dec
+ basic_os=tops20
+ ;;
+ delta | 3300 | motorola-3300 | motorola-delta \
+ | 3300-motorola | delta-motorola)
+ cpu=m68k
+ vendor=motorola
+ ;;
+ dpx2*)
+ cpu=m68k
+ vendor=bull
+ basic_os=sysv3
+ ;;
+ encore | umax | mmax)
+ cpu=ns32k
+ vendor=encore
+ ;;
+ elxsi)
+ cpu=elxsi
+ vendor=elxsi
+ basic_os=${basic_os:-bsd}
+ ;;
+ fx2800)
+ cpu=i860
+ vendor=alliant
+ ;;
+ genix)
+ cpu=ns32k
+ vendor=ns
+ ;;
+ h3050r* | hiux*)
+ cpu=hppa1.1
+ vendor=hitachi
+ basic_os=hiuxwe2
+ ;;
+ hp3k9[0-9][0-9] | hp9[0-9][0-9])
+ cpu=hppa1.0
+ vendor=hp
+ ;;
+ hp9k2[0-9][0-9] | hp9k31[0-9])
+ cpu=m68000
+ vendor=hp
+ ;;
+ hp9k3[2-9][0-9])
+ cpu=m68k
+ vendor=hp
+ ;;
+ hp9k6[0-9][0-9] | hp6[0-9][0-9])
+ cpu=hppa1.0
+ vendor=hp
+ ;;
+ hp9k7[0-79][0-9] | hp7[0-79][0-9])
+ cpu=hppa1.1
+ vendor=hp
+ ;;
+ hp9k78[0-9] | hp78[0-9])
+ # FIXME: really hppa2.0-hp
+ cpu=hppa1.1
+ vendor=hp
+ ;;
+ hp9k8[67]1 | hp8[67]1 | hp9k80[24] | hp80[24] | hp9k8[78]9 | hp8[78]9 | hp9k893 | hp893)
+ # FIXME: really hppa2.0-hp
+ cpu=hppa1.1
+ vendor=hp
+ ;;
+ hp9k8[0-9][13679] | hp8[0-9][13679])
+ cpu=hppa1.1
+ vendor=hp
+ ;;
+ hp9k8[0-9][0-9] | hp8[0-9][0-9])
+ cpu=hppa1.0
+ vendor=hp
+ ;;
+ i*86v32)
+ cpu=$(echo "$1" | sed -e 's/86.*/86/')
+ vendor=pc
+ basic_os=sysv32
+ ;;
+ i*86v4*)
+ cpu=$(echo "$1" | sed -e 's/86.*/86/')
+ vendor=pc
+ basic_os=sysv4
+ ;;
+ i*86v)
+ cpu=$(echo "$1" | sed -e 's/86.*/86/')
+ vendor=pc
+ basic_os=sysv
+ ;;
+ i*86sol2)
+ cpu=$(echo "$1" | sed -e 's/86.*/86/')
+ vendor=pc
+ basic_os=solaris2
+ ;;
+ j90 | j90-cray)
+ cpu=j90
+ vendor=cray
+ basic_os=${basic_os:-unicos}
+ ;;
+ iris | iris4d)
+ cpu=mips
+ vendor=sgi
+ case $basic_os in
+ irix*)
+ ;;
+ *)
+ basic_os=irix4
+ ;;
+ esac
+ ;;
+ miniframe)
+ cpu=m68000
+ vendor=convergent
+ ;;
+ *mint | mint[0-9]* | *MiNT | *MiNT[0-9]*)
+ cpu=m68k
+ vendor=atari
+ basic_os=mint
+ ;;
+ news-3600 | risc-news)
+ cpu=mips
+ vendor=sony
+ basic_os=newsos
+ ;;
+ next | m*-next)
+ cpu=m68k
+ vendor=next
+ case $basic_os in
+ openstep*)
+ ;;
+ nextstep*)
+ ;;
+ ns2*)
+ basic_os=nextstep2
+ ;;
+ *)
+ basic_os=nextstep3
+ ;;
+ esac
+ ;;
+ np1)
+ cpu=np1
+ vendor=gould
+ ;;
+ op50n-* | op60c-*)
+ cpu=hppa1.1
+ vendor=oki
+ basic_os=proelf
+ ;;
+ pa-hitachi)
+ cpu=hppa1.1
+ vendor=hitachi
+ basic_os=hiuxwe2
+ ;;
+ pbd)
+ cpu=sparc
+ vendor=tti
+ ;;
+ pbb)
+ cpu=m68k
+ vendor=tti
+ ;;
+ pc532)
+ cpu=ns32k
+ vendor=pc532
+ ;;
+ pn)
+ cpu=pn
+ vendor=gould
+ ;;
+ power)
+ cpu=power
+ vendor=ibm
+ ;;
+ ps2)
+ cpu=i386
+ vendor=ibm
+ ;;
+ rm[46]00)
+ cpu=mips
+ vendor=siemens
+ ;;
+ rtpc | rtpc-*)
+ cpu=romp
+ vendor=ibm
+ ;;
+ sde)
+ cpu=mipsisa32
+ vendor=sde
+ basic_os=${basic_os:-elf}
+ ;;
+ simso-wrs)
+ cpu=sparclite
+ vendor=wrs
+ basic_os=vxworks
+ ;;
+ tower | tower-32)
+ cpu=m68k
+ vendor=ncr
+ ;;
+ vpp*|vx|vx-*)
+ cpu=f301
+ vendor=fujitsu
+ ;;
+ w65)
+ cpu=w65
+ vendor=wdc
+ ;;
+ w89k-*)
+ cpu=hppa1.1
+ vendor=winbond
+ basic_os=proelf
+ ;;
+ none)
+ cpu=none
+ vendor=none
+ ;;
+ leon|leon[3-9])
+ cpu=sparc
+ vendor=$basic_machine
+ ;;
+ leon-*|leon[3-9]-*)
+ cpu=sparc
+ vendor=$(echo "$basic_machine" | sed 's/-.*//')
+ ;;
+
+ *-*)
+ # shellcheck disable=SC2162
+ IFS="-" read cpu vendor <&2
+ exit 1
+ ;;
+ esac
+ ;;
+esac
+
+# Here we canonicalize certain aliases for manufacturers.
+case $vendor in
+ digital*)
+ vendor=dec
+ ;;
+ commodore*)
+ vendor=cbm
+ ;;
+ *)
+ ;;
+esac
+
+# Decode manufacturer-specific aliases for certain operating systems.
+
+if test x$basic_os != x
+then
+
+# First recognize some ad-hoc caes, or perhaps split kernel-os, or else just
+# set os.
+case $basic_os in
+ gnu/linux*)
+ kernel=linux
+ os=$(echo $basic_os | sed -e 's|gnu/linux|gnu|')
+ ;;
+ os2-emx)
+ kernel=os2
+ os=$(echo $basic_os | sed -e 's|os2-emx|emx|')
+ ;;
+ nto-qnx*)
+ kernel=nto
+ os=$(echo $basic_os | sed -e 's|nto-qnx|qnx|')
+ ;;
+ *-*)
+ # shellcheck disable=SC2162
+ IFS="-" read kernel os <&2
+ exit 1
+ ;;
+esac
+
+# As a final step for OS-related things, validate the OS-kernel combination
+# (given a valid OS), if there is a kernel.
+case $kernel-$os in
+ linux-gnu* | linux-dietlibc* | linux-android* | linux-newlib* | linux-musl* | linux-uclibc* )
+ ;;
+ uclinux-uclibc* )
+ ;;
+ -dietlibc* | -newlib* | -musl* | -uclibc* )
+ # These are just libc implementations, not actual OSes, and thus
+ # require a kernel.
+ echo "Invalid configuration \`$1': libc \`$os' needs explicit kernel." 1>&2
+ exit 1
+ ;;
+ kfreebsd*-gnu* | kopensolaris*-gnu*)
+ ;;
+ vxworks-simlinux | vxworks-simwindows | vxworks-spe)
+ ;;
+ nto-qnx*)
+ ;;
+ os2-emx)
+ ;;
+ *-eabi* | *-gnueabi*)
+ ;;
+ -*)
+ # Blank kernel with real OS is always fine.
+ ;;
+ *-*)
+ echo "Invalid configuration \`$1': Kernel \`$kernel' not known to work with OS \`$os'." 1>&2
+ exit 1
+ ;;
+esac
+
+# Here we handle the case where we know the os, and the CPU type, but not the
+# manufacturer. We pick the logical manufacturer.
+case $vendor in
+ unknown)
+ case $cpu-$os in
+ *-riscix*)
+ vendor=acorn
+ ;;
+ *-sunos*)
+ vendor=sun
+ ;;
+ *-cnk* | *-aix*)
+ vendor=ibm
+ ;;
+ *-beos*)
+ vendor=be
+ ;;
+ *-hpux*)
+ vendor=hp
+ ;;
+ *-mpeix*)
+ vendor=hp
+ ;;
+ *-hiux*)
+ vendor=hitachi
+ ;;
+ *-unos*)
+ vendor=crds
+ ;;
+ *-dgux*)
+ vendor=dg
+ ;;
+ *-luna*)
+ vendor=omron
+ ;;
+ *-genix*)
+ vendor=ns
+ ;;
+ *-clix*)
+ vendor=intergraph
+ ;;
+ *-mvs* | *-opened*)
+ vendor=ibm
+ ;;
+ *-os400*)
+ vendor=ibm
+ ;;
+ s390-* | s390x-*)
+ vendor=ibm
+ ;;
+ *-ptx*)
+ vendor=sequent
+ ;;
+ *-tpf*)
+ vendor=ibm
+ ;;
+ *-vxsim* | *-vxworks* | *-windiss*)
+ vendor=wrs
+ ;;
+ *-aux*)
+ vendor=apple
+ ;;
+ *-hms*)
+ vendor=hitachi
+ ;;
+ *-mpw* | *-macos*)
+ vendor=apple
+ ;;
+ *-*mint | *-mint[0-9]* | *-*MiNT | *-MiNT[0-9]*)
+ vendor=atari
+ ;;
+ *-vos*)
+ vendor=stratus
+ ;;
+ esac
+ ;;
+esac
+
+echo "$cpu-$vendor-${kernel:+$kernel-}$os"
+exit
+
+# Local variables:
+# eval: (add-hook 'before-save-hook 'time-stamp)
+# time-stamp-start: "timestamp='"
+# time-stamp-format: "%:y-%02m-%02d"
+# time-stamp-end: "'"
+# End:
diff --git a/build-aux/install-sh b/build-aux/install-sh
new file mode 100755
index 0000000..ec298b5
--- /dev/null
+++ b/build-aux/install-sh
@@ -0,0 +1,541 @@
+#!/bin/sh
+# install - install a program, script, or datafile
+
+scriptversion=2020-11-14.01; # UTC
+
+# This originates from X11R5 (mit/util/scripts/install.sh), which was
+# later released in X11R6 (xc/config/util/install.sh) with the
+# following copyright and license.
+#
+# Copyright (C) 1994 X Consortium
+#
+# Permission is hereby granted, free of charge, to any person obtaining a copy
+# of this software and associated documentation files (the "Software"), to
+# deal in the Software without restriction, including without limitation the
+# rights to use, copy, modify, merge, publish, distribute, sublicense, and/or
+# sell copies of the Software, and to permit persons to whom the Software is
+# furnished to do so, subject to the following conditions:
+#
+# The above copyright notice and this permission notice shall be included in
+# all copies or substantial portions of the Software.
+#
+# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+# IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
+# X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN
+# AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC-
+# TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.
+#
+# Except as contained in this notice, the name of the X Consortium shall not
+# be used in advertising or otherwise to promote the sale, use or other deal-
+# ings in this Software without prior written authorization from the X Consor-
+# tium.
+#
+#
+# FSF changes to this file are in the public domain.
+#
+# Calling this script install-sh is preferred over install.sh, to prevent
+# 'make' implicit rules from creating a file called install from it
+# when there is no Makefile.
+#
+# This script is compatible with the BSD install script, but was written
+# from scratch.
+
+tab=' '
+nl='
+'
+IFS=" $tab$nl"
+
+# Set DOITPROG to "echo" to test this script.
+
+doit=${DOITPROG-}
+doit_exec=${doit:-exec}
+
+# Put in absolute file names if you don't have them in your path;
+# or use environment vars.
+
+chgrpprog=${CHGRPPROG-chgrp}
+chmodprog=${CHMODPROG-chmod}
+chownprog=${CHOWNPROG-chown}
+cmpprog=${CMPPROG-cmp}
+cpprog=${CPPROG-cp}
+mkdirprog=${MKDIRPROG-mkdir}
+mvprog=${MVPROG-mv}
+rmprog=${RMPROG-rm}
+stripprog=${STRIPPROG-strip}
+
+posix_mkdir=
+
+# Desired mode of installed file.
+mode=0755
+
+# Create dirs (including intermediate dirs) using mode 755.
+# This is like GNU 'install' as of coreutils 8.32 (2020).
+mkdir_umask=22
+
+backupsuffix=
+chgrpcmd=
+chmodcmd=$chmodprog
+chowncmd=
+mvcmd=$mvprog
+rmcmd="$rmprog -f"
+stripcmd=
+
+src=
+dst=
+dir_arg=
+dst_arg=
+
+copy_on_change=false
+is_target_a_directory=possibly
+
+usage="\
+Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE
+ or: $0 [OPTION]... SRCFILES... DIRECTORY
+ or: $0 [OPTION]... -t DIRECTORY SRCFILES...
+ or: $0 [OPTION]... -d DIRECTORIES...
+
+In the 1st form, copy SRCFILE to DSTFILE.
+In the 2nd and 3rd, copy all SRCFILES to DIRECTORY.
+In the 4th, create DIRECTORIES.
+
+Options:
+ --help display this help and exit.
+ --version display version info and exit.
+
+ -c (ignored)
+ -C install only if different (preserve data modification time)
+ -d create directories instead of installing files.
+ -g GROUP $chgrpprog installed files to GROUP.
+ -m MODE $chmodprog installed files to MODE.
+ -o USER $chownprog installed files to USER.
+ -p pass -p to $cpprog.
+ -s $stripprog installed files.
+ -S SUFFIX attempt to back up existing files, with suffix SUFFIX.
+ -t DIRECTORY install into DIRECTORY.
+ -T report an error if DSTFILE is a directory.
+
+Environment variables override the default commands:
+ CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG
+ RMPROG STRIPPROG
+
+By default, rm is invoked with -f; when overridden with RMPROG,
+it's up to you to specify -f if you want it.
+
+If -S is not specified, no backups are attempted.
+
+Email bug reports to bug-automake@gnu.org.
+Automake home page: https://www.gnu.org/software/automake/
+"
+
+while test $# -ne 0; do
+ case $1 in
+ -c) ;;
+
+ -C) copy_on_change=true;;
+
+ -d) dir_arg=true;;
+
+ -g) chgrpcmd="$chgrpprog $2"
+ shift;;
+
+ --help) echo "$usage"; exit $?;;
+
+ -m) mode=$2
+ case $mode in
+ *' '* | *"$tab"* | *"$nl"* | *'*'* | *'?'* | *'['*)
+ echo "$0: invalid mode: $mode" >&2
+ exit 1;;
+ esac
+ shift;;
+
+ -o) chowncmd="$chownprog $2"
+ shift;;
+
+ -p) cpprog="$cpprog -p";;
+
+ -s) stripcmd=$stripprog;;
+
+ -S) backupsuffix="$2"
+ shift;;
+
+ -t)
+ is_target_a_directory=always
+ dst_arg=$2
+ # Protect names problematic for 'test' and other utilities.
+ case $dst_arg in
+ -* | [=\(\)!]) dst_arg=./$dst_arg;;
+ esac
+ shift;;
+
+ -T) is_target_a_directory=never;;
+
+ --version) echo "$0 $scriptversion"; exit $?;;
+
+ --) shift
+ break;;
+
+ -*) echo "$0: invalid option: $1" >&2
+ exit 1;;
+
+ *) break;;
+ esac
+ shift
+done
+
+# We allow the use of options -d and -T together, by making -d
+# take the precedence; this is for compatibility with GNU install.
+
+if test -n "$dir_arg"; then
+ if test -n "$dst_arg"; then
+ echo "$0: target directory not allowed when installing a directory." >&2
+ exit 1
+ fi
+fi
+
+if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then
+ # When -d is used, all remaining arguments are directories to create.
+ # When -t is used, the destination is already specified.
+ # Otherwise, the last argument is the destination. Remove it from $@.
+ for arg
+ do
+ if test -n "$dst_arg"; then
+ # $@ is not empty: it contains at least $arg.
+ set fnord "$@" "$dst_arg"
+ shift # fnord
+ fi
+ shift # arg
+ dst_arg=$arg
+ # Protect names problematic for 'test' and other utilities.
+ case $dst_arg in
+ -* | [=\(\)!]) dst_arg=./$dst_arg;;
+ esac
+ done
+fi
+
+if test $# -eq 0; then
+ if test -z "$dir_arg"; then
+ echo "$0: no input file specified." >&2
+ exit 1
+ fi
+ # It's OK to call 'install-sh -d' without argument.
+ # This can happen when creating conditional directories.
+ exit 0
+fi
+
+if test -z "$dir_arg"; then
+ if test $# -gt 1 || test "$is_target_a_directory" = always; then
+ if test ! -d "$dst_arg"; then
+ echo "$0: $dst_arg: Is not a directory." >&2
+ exit 1
+ fi
+ fi
+fi
+
+if test -z "$dir_arg"; then
+ do_exit='(exit $ret); exit $ret'
+ trap "ret=129; $do_exit" 1
+ trap "ret=130; $do_exit" 2
+ trap "ret=141; $do_exit" 13
+ trap "ret=143; $do_exit" 15
+
+ # Set umask so as not to create temps with too-generous modes.
+ # However, 'strip' requires both read and write access to temps.
+ case $mode in
+ # Optimize common cases.
+ *644) cp_umask=133;;
+ *755) cp_umask=22;;
+
+ *[0-7])
+ if test -z "$stripcmd"; then
+ u_plus_rw=
+ else
+ u_plus_rw='% 200'
+ fi
+ cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;;
+ *)
+ if test -z "$stripcmd"; then
+ u_plus_rw=
+ else
+ u_plus_rw=,u+rw
+ fi
+ cp_umask=$mode$u_plus_rw;;
+ esac
+fi
+
+for src
+do
+ # Protect names problematic for 'test' and other utilities.
+ case $src in
+ -* | [=\(\)!]) src=./$src;;
+ esac
+
+ if test -n "$dir_arg"; then
+ dst=$src
+ dstdir=$dst
+ test -d "$dstdir"
+ dstdir_status=$?
+ # Don't chown directories that already exist.
+ if test $dstdir_status = 0; then
+ chowncmd=""
+ fi
+ else
+
+ # Waiting for this to be detected by the "$cpprog $src $dsttmp" command
+ # might cause directories to be created, which would be especially bad
+ # if $src (and thus $dsttmp) contains '*'.
+ if test ! -f "$src" && test ! -d "$src"; then
+ echo "$0: $src does not exist." >&2
+ exit 1
+ fi
+
+ if test -z "$dst_arg"; then
+ echo "$0: no destination specified." >&2
+ exit 1
+ fi
+ dst=$dst_arg
+
+ # If destination is a directory, append the input filename.
+ if test -d "$dst"; then
+ if test "$is_target_a_directory" = never; then
+ echo "$0: $dst_arg: Is a directory" >&2
+ exit 1
+ fi
+ dstdir=$dst
+ dstbase=`basename "$src"`
+ case $dst in
+ */) dst=$dst$dstbase;;
+ *) dst=$dst/$dstbase;;
+ esac
+ dstdir_status=0
+ else
+ dstdir=`dirname "$dst"`
+ test -d "$dstdir"
+ dstdir_status=$?
+ fi
+ fi
+
+ case $dstdir in
+ */) dstdirslash=$dstdir;;
+ *) dstdirslash=$dstdir/;;
+ esac
+
+ obsolete_mkdir_used=false
+
+ if test $dstdir_status != 0; then
+ case $posix_mkdir in
+ '')
+ # With -d, create the new directory with the user-specified mode.
+ # Otherwise, rely on $mkdir_umask.
+ if test -n "$dir_arg"; then
+ mkdir_mode=-m$mode
+ else
+ mkdir_mode=
+ fi
+
+ posix_mkdir=false
+ # The $RANDOM variable is not portable (e.g., dash). Use it
+ # here however when possible just to lower collision chance.
+ tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$
+
+ trap '
+ ret=$?
+ rmdir "$tmpdir/a/b" "$tmpdir/a" "$tmpdir" 2>/dev/null
+ exit $ret
+ ' 0
+
+ # Because "mkdir -p" follows existing symlinks and we likely work
+ # directly in world-writeable /tmp, make sure that the '$tmpdir'
+ # directory is successfully created first before we actually test
+ # 'mkdir -p'.
+ if (umask $mkdir_umask &&
+ $mkdirprog $mkdir_mode "$tmpdir" &&
+ exec $mkdirprog $mkdir_mode -p -- "$tmpdir/a/b") >/dev/null 2>&1
+ then
+ if test -z "$dir_arg" || {
+ # Check for POSIX incompatibilities with -m.
+ # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or
+ # other-writable bit of parent directory when it shouldn't.
+ # FreeBSD 6.1 mkdir -m -p sets mode of existing directory.
+ test_tmpdir="$tmpdir/a"
+ ls_ld_tmpdir=`ls -ld "$test_tmpdir"`
+ case $ls_ld_tmpdir in
+ d????-?r-*) different_mode=700;;
+ d????-?--*) different_mode=755;;
+ *) false;;
+ esac &&
+ $mkdirprog -m$different_mode -p -- "$test_tmpdir" && {
+ ls_ld_tmpdir_1=`ls -ld "$test_tmpdir"`
+ test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1"
+ }
+ }
+ then posix_mkdir=:
+ fi
+ rmdir "$tmpdir/a/b" "$tmpdir/a" "$tmpdir"
+ else
+ # Remove any dirs left behind by ancient mkdir implementations.
+ rmdir ./$mkdir_mode ./-p ./-- "$tmpdir" 2>/dev/null
+ fi
+ trap '' 0;;
+ esac
+
+ if
+ $posix_mkdir && (
+ umask $mkdir_umask &&
+ $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir"
+ )
+ then :
+ else
+
+ # mkdir does not conform to POSIX,
+ # or it failed possibly due to a race condition. Create the
+ # directory the slow way, step by step, checking for races as we go.
+
+ case $dstdir in
+ /*) prefix='/';;
+ [-=\(\)!]*) prefix='./';;
+ *) prefix='';;
+ esac
+
+ oIFS=$IFS
+ IFS=/
+ set -f
+ set fnord $dstdir
+ shift
+ set +f
+ IFS=$oIFS
+
+ prefixes=
+
+ for d
+ do
+ test X"$d" = X && continue
+
+ prefix=$prefix$d
+ if test -d "$prefix"; then
+ prefixes=
+ else
+ if $posix_mkdir; then
+ (umask $mkdir_umask &&
+ $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break
+ # Don't fail if two instances are running concurrently.
+ test -d "$prefix" || exit 1
+ else
+ case $prefix in
+ *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;;
+ *) qprefix=$prefix;;
+ esac
+ prefixes="$prefixes '$qprefix'"
+ fi
+ fi
+ prefix=$prefix/
+ done
+
+ if test -n "$prefixes"; then
+ # Don't fail if two instances are running concurrently.
+ (umask $mkdir_umask &&
+ eval "\$doit_exec \$mkdirprog $prefixes") ||
+ test -d "$dstdir" || exit 1
+ obsolete_mkdir_used=true
+ fi
+ fi
+ fi
+
+ if test -n "$dir_arg"; then
+ { test -z "$chowncmd" || $doit $chowncmd "$dst"; } &&
+ { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } &&
+ { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false ||
+ test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1
+ else
+
+ # Make a couple of temp file names in the proper directory.
+ dsttmp=${dstdirslash}_inst.$$_
+ rmtmp=${dstdirslash}_rm.$$_
+
+ # Trap to clean up those temp files at exit.
+ trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0
+
+ # Copy the file name to the temp name.
+ (umask $cp_umask &&
+ { test -z "$stripcmd" || {
+ # Create $dsttmp read-write so that cp doesn't create it read-only,
+ # which would cause strip to fail.
+ if test -z "$doit"; then
+ : >"$dsttmp" # No need to fork-exec 'touch'.
+ else
+ $doit touch "$dsttmp"
+ fi
+ }
+ } &&
+ $doit_exec $cpprog "$src" "$dsttmp") &&
+
+ # and set any options; do chmod last to preserve setuid bits.
+ #
+ # If any of these fail, we abort the whole thing. If we want to
+ # ignore errors from any of these, just make sure not to ignore
+ # errors from the above "$doit $cpprog $src $dsttmp" command.
+ #
+ { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } &&
+ { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } &&
+ { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } &&
+ { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } &&
+
+ # If -C, don't bother to copy if it wouldn't change the file.
+ if $copy_on_change &&
+ old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` &&
+ new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` &&
+ set -f &&
+ set X $old && old=:$2:$4:$5:$6 &&
+ set X $new && new=:$2:$4:$5:$6 &&
+ set +f &&
+ test "$old" = "$new" &&
+ $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1
+ then
+ rm -f "$dsttmp"
+ else
+ # If $backupsuffix is set, and the file being installed
+ # already exists, attempt a backup. Don't worry if it fails,
+ # e.g., if mv doesn't support -f.
+ if test -n "$backupsuffix" && test -f "$dst"; then
+ $doit $mvcmd -f "$dst" "$dst$backupsuffix" 2>/dev/null
+ fi
+
+ # Rename the file to the real destination.
+ $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null ||
+
+ # The rename failed, perhaps because mv can't rename something else
+ # to itself, or perhaps because mv is so ancient that it does not
+ # support -f.
+ {
+ # Now remove or move aside any old file at destination location.
+ # We try this two ways since rm can't unlink itself on some
+ # systems and the destination file might be busy for other
+ # reasons. In this case, the final cleanup might fail but the new
+ # file should still install successfully.
+ {
+ test ! -f "$dst" ||
+ $doit $rmcmd "$dst" 2>/dev/null ||
+ { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null &&
+ { $doit $rmcmd "$rmtmp" 2>/dev/null; :; }
+ } ||
+ { echo "$0: cannot unlink or rename $dst" >&2
+ (exit 1); exit 1
+ }
+ } &&
+
+ # Now rename the file to the real destination.
+ $doit $mvcmd "$dsttmp" "$dst"
+ }
+ fi || exit 1
+
+ trap '' 0
+ fi
+done
+
+# Local variables:
+# eval: (add-hook 'before-save-hook 'time-stamp)
+# time-stamp-start: "scriptversion="
+# time-stamp-format: "%:y-%02m-%02d.%02H"
+# time-stamp-time-zone: "UTC0"
+# time-stamp-end: "; # UTC"
+# End:
diff --git a/configure b/configure
index 6d51d81..de45002 100755
--- a/configure
+++ b/configure
@@ -1,9 +1,10 @@
#! /bin/sh
# Guess values for system-dependent variables and create Makefiles.
-# Generated by GNU Autoconf 2.69 for seedtool-cli 0.10.2.
+# Generated by GNU Autoconf 2.71 for seedtool-cli 0.11.0.
#
#
-# Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc.
+# Copyright (C) 1992-1996, 1998-2017, 2020-2021 Free Software Foundation,
+# Inc.
#
#
# This configure script is free software; the Free Software Foundation
@@ -14,14 +15,16 @@
# Be more Bourne compatible
DUALCASE=1; export DUALCASE # for MKS sh
-if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+as_nop=:
+if test ${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1
+then :
emulate sh
NULLCMD=:
# Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
# is contrary to our usage. Disable this feature.
alias -g '${1+"$@"}'='"$@"'
setopt NO_GLOB_SUBST
-else
+else $as_nop
case `(set -o) 2>/dev/null` in #(
*posix*) :
set -o posix ;; #(
@@ -31,46 +34,46 @@ esac
fi
+
+# Reset variables that may have inherited troublesome values from
+# the environment.
+
+# IFS needs to be set, to space, tab, and newline, in precisely that order.
+# (If _AS_PATH_WALK were called with IFS unset, it would have the
+# side effect of setting IFS to empty, thus disabling word splitting.)
+# Quoting is to prevent editors from complaining about space-tab.
as_nl='
'
export as_nl
-# Printing a long string crashes Solaris 7 /usr/bin/printf.
-as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
-as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
-as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
-# Prefer a ksh shell builtin over an external printf program on Solaris,
-# but without wasting forks for bash or zsh.
-if test -z "$BASH_VERSION$ZSH_VERSION" \
- && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
- as_echo='print -r --'
- as_echo_n='print -rn --'
-elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
- as_echo='printf %s\n'
- as_echo_n='printf %s'
-else
- if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
- as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
- as_echo_n='/usr/ucb/echo -n'
- else
- as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
- as_echo_n_body='eval
- arg=$1;
- case $arg in #(
- *"$as_nl"*)
- expr "X$arg" : "X\\(.*\\)$as_nl";
- arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
- esac;
- expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
- '
- export as_echo_n_body
- as_echo_n='sh -c $as_echo_n_body as_echo'
- fi
- export as_echo_body
- as_echo='sh -c $as_echo_body as_echo'
-fi
+IFS=" "" $as_nl"
+
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# Ensure predictable behavior from utilities with locale-dependent output.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# We cannot yet rely on "unset" to work, but we need these variables
+# to be unset--not just set to an empty or harmless value--now, to
+# avoid bugs in old shells (e.g. pre-3.0 UWIN ksh). This construct
+# also avoids known problems related to "unset" and subshell syntax
+# in other old shells (e.g. bash 2.01 and pdksh 5.2.14).
+for as_var in BASH_ENV ENV MAIL MAILPATH CDPATH
+do eval test \${$as_var+y} \
+ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+
+# Ensure that fds 0, 1, and 2 are open.
+if (exec 3>&0) 2>/dev/null; then :; else exec 0&1) 2>/dev/null; then :; else exec 1>/dev/null; fi
+if (exec 3>&2) ; then :; else exec 2>/dev/null; fi
# The user is always right.
-if test "${PATH_SEPARATOR+set}" != set; then
+if ${PATH_SEPARATOR+false} :; then
PATH_SEPARATOR=:
(PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
(PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
@@ -79,13 +82,6 @@ if test "${PATH_SEPARATOR+set}" != set; then
fi
-# IFS
-# We need space, tab and new line, in precisely that order. Quoting is
-# there to prevent editors from complaining about space-tab.
-# (If _AS_PATH_WALK were called with IFS unset, it would disable word
-# splitting by setting IFS to empty value.)
-IFS=" "" $as_nl"
-
# Find who we are. Look in the path if we contain no directory separator.
as_myself=
case $0 in #((
@@ -94,8 +90,12 @@ case $0 in #((
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ test -r "$as_dir$0" && as_myself=$as_dir$0 && break
done
IFS=$as_save_IFS
@@ -107,30 +107,10 @@ if test "x$as_myself" = x; then
as_myself=$0
fi
if test ! -f "$as_myself"; then
- $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ printf "%s\n" "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
exit 1
fi
-# Unset variables that we do not need and which cause bugs (e.g. in
-# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1"
-# suppresses any "Segmentation fault" message there. '((' could
-# trigger a bug in pdksh 5.2.14.
-for as_var in BASH_ENV ENV MAIL MAILPATH
-do eval test x\${$as_var+set} = xset \
- && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
-done
-PS1='$ '
-PS2='> '
-PS4='+ '
-
-# NLS nuisances.
-LC_ALL=C
-export LC_ALL
-LANGUAGE=C
-export LANGUAGE
-
-# CDPATH.
-(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
# Use a proper internal environment variable to ensure we don't fall
# into an infinite loop, continuously re-executing ourselves.
@@ -152,20 +132,22 @@ esac
exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"}
# Admittedly, this is quite paranoid, since all the known shells bail
# out after a failed `exec'.
-$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2
-as_fn_exit 255
+printf "%s\n" "$0: could not re-execute with $CONFIG_SHELL" >&2
+exit 255
fi
# We don't want this to propagate to other subprocesses.
{ _as_can_reexec=; unset _as_can_reexec;}
if test "x$CONFIG_SHELL" = x; then
- as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then :
+ as_bourne_compatible="as_nop=:
+if test \${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1
+then :
emulate sh
NULLCMD=:
# Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which
# is contrary to our usage. Disable this feature.
alias -g '\${1+\"\$@\"}'='\"\$@\"'
setopt NO_GLOB_SUBST
-else
+else \$as_nop
case \`(set -o) 2>/dev/null\` in #(
*posix*) :
set -o posix ;; #(
@@ -185,42 +167,52 @@ as_fn_success || { exitcode=1; echo as_fn_success failed.; }
as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; }
as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; }
as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; }
-if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then :
+if ( set x; as_fn_ret_success y && test x = \"\$1\" )
+then :
-else
+else \$as_nop
exitcode=1; echo positional parameters were not saved.
fi
test x\$exitcode = x0 || exit 1
+blah=\$(echo \$(echo blah))
+test x\"\$blah\" = xblah || exit 1
test -x / || exit 1"
as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO
as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO
eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" &&
- test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1
-test \$(( 1 + 1 )) = 2 || exit 1"
- if (eval "$as_required") 2>/dev/null; then :
+ test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1"
+ if (eval "$as_required") 2>/dev/null
+then :
as_have_required=yes
-else
+else $as_nop
as_have_required=no
fi
- if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then :
+ if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null
+then :
-else
+else $as_nop
as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
as_found=false
for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
as_found=:
case $as_dir in #(
/*)
for as_base in sh bash ksh sh5; do
# Try only shells that exist, to save several forks.
- as_shell=$as_dir/$as_base
+ as_shell=$as_dir$as_base
if { test -f "$as_shell" || test -f "$as_shell.exe"; } &&
- { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then :
+ as_run=a "$as_shell" -c "$as_bourne_compatible""$as_required" 2>/dev/null
+then :
CONFIG_SHELL=$as_shell as_have_required=yes
- if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then :
+ if as_run=a "$as_shell" -c "$as_bourne_compatible""$as_suggested" 2>/dev/null
+then :
break 2
fi
fi
@@ -228,14 +220,21 @@ fi
esac
as_found=false
done
-$as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } &&
- { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then :
- CONFIG_SHELL=$SHELL as_have_required=yes
-fi; }
IFS=$as_save_IFS
+if $as_found
+then :
+
+else $as_nop
+ if { test -f "$SHELL" || test -f "$SHELL.exe"; } &&
+ as_run=a "$SHELL" -c "$as_bourne_compatible""$as_required" 2>/dev/null
+then :
+ CONFIG_SHELL=$SHELL as_have_required=yes
+fi
+fi
- if test "x$CONFIG_SHELL" != x; then :
+ if test "x$CONFIG_SHELL" != x
+then :
export CONFIG_SHELL
# We cannot yet assume a decent shell, so we have to provide a
# neutralization value for shells without unset; and this also
@@ -253,18 +252,19 @@ esac
exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"}
# Admittedly, this is quite paranoid, since all the known shells bail
# out after a failed `exec'.
-$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2
+printf "%s\n" "$0: could not re-execute with $CONFIG_SHELL" >&2
exit 255
fi
- if test x$as_have_required = xno; then :
- $as_echo "$0: This script requires a shell more modern than all"
- $as_echo "$0: the shells that I found on your system."
- if test x${ZSH_VERSION+set} = xset ; then
- $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should"
- $as_echo "$0: be upgraded to zsh 4.3.4 or later."
+ if test x$as_have_required = xno
+then :
+ printf "%s\n" "$0: This script requires a shell more modern than all"
+ printf "%s\n" "$0: the shells that I found on your system."
+ if test ${ZSH_VERSION+y} ; then
+ printf "%s\n" "$0: In particular, zsh $ZSH_VERSION has bugs and should"
+ printf "%s\n" "$0: be upgraded to zsh 4.3.4 or later."
else
- $as_echo "$0: Please tell bug-autoconf@gnu.org about your system,
+ printf "%s\n" "$0: Please tell bug-autoconf@gnu.org about your system,
$0: including any error possibly output before this
$0: message. Then install a modern shell, or manually run
$0: the script under such a shell if you do have one."
@@ -291,6 +291,7 @@ as_fn_unset ()
}
as_unset=as_fn_unset
+
# as_fn_set_status STATUS
# -----------------------
# Set $? to STATUS, without forking.
@@ -308,6 +309,14 @@ as_fn_exit ()
as_fn_set_status $1
exit $1
} # as_fn_exit
+# as_fn_nop
+# ---------
+# Do nothing but, unlike ":", preserve the value of $?.
+as_fn_nop ()
+{
+ return $?
+}
+as_nop=as_fn_nop
# as_fn_mkdir_p
# -------------
@@ -322,7 +331,7 @@ as_fn_mkdir_p ()
as_dirs=
while :; do
case $as_dir in #(
- *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+ *\'*) as_qdir=`printf "%s\n" "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
*) as_qdir=$as_dir;;
esac
as_dirs="'$as_qdir' $as_dirs"
@@ -331,7 +340,7 @@ $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
X"$as_dir" : 'X\(//\)[^/]' \| \
X"$as_dir" : 'X\(//\)$' \| \
X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X"$as_dir" |
+printf "%s\n" X"$as_dir" |
sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
s//\1/
q
@@ -370,12 +379,13 @@ as_fn_executable_p ()
# advantage of any shell optimizations that allow amortized linear growth over
# repeated appends, instead of the typical quadratic growth present in naive
# implementations.
-if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null
+then :
eval 'as_fn_append ()
{
eval $1+=\$2
}'
-else
+else $as_nop
as_fn_append ()
{
eval $1=\$$1\$2
@@ -387,18 +397,27 @@ fi # as_fn_append
# Perform arithmetic evaluation on the ARGs, and store the result in the
# global $as_val. Take advantage of shells that can avoid forks. The arguments
# must be portable across $(()) and expr.
-if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null
+then :
eval 'as_fn_arith ()
{
as_val=$(( $* ))
}'
-else
+else $as_nop
as_fn_arith ()
{
as_val=`expr "$@" || test $? -eq 1`
}
fi # as_fn_arith
+# as_fn_nop
+# ---------
+# Do nothing but, unlike ":", preserve the value of $?.
+as_fn_nop ()
+{
+ return $?
+}
+as_nop=as_fn_nop
# as_fn_error STATUS ERROR [LINENO LOG_FD]
# ----------------------------------------
@@ -410,9 +429,9 @@ as_fn_error ()
as_status=$1; test $as_status -eq 0 && as_status=1
if test "$4"; then
as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
fi
- $as_echo "$as_me: error: $2" >&2
+ printf "%s\n" "$as_me: error: $2" >&2
as_fn_exit $as_status
} # as_fn_error
@@ -439,7 +458,7 @@ as_me=`$as_basename -- "$0" ||
$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
X"$0" : 'X\(//\)$' \| \
X"$0" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X/"$0" |
+printf "%s\n" X/"$0" |
sed '/^.*\/\([^/][^/]*\)\/*$/{
s//\1/
q
@@ -483,7 +502,7 @@ as_cr_alnum=$as_cr_Letters$as_cr_digits
s/-\n.*//
' >$as_me.lineno &&
chmod +x "$as_me.lineno" ||
- { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; }
+ { printf "%s\n" "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; }
# If we had to re-execute with $CONFIG_SHELL, we're ensured to have
# already done that, so ensure we don't try to do so again and fall
@@ -497,6 +516,10 @@ as_cr_alnum=$as_cr_Letters$as_cr_digits
exit
}
+
+# Determine whether it's possible to make 'echo' print without a newline.
+# These variables are no longer used directly by Autoconf, but are AC_SUBSTed
+# for compatibility with existing Makefiles.
ECHO_C= ECHO_N= ECHO_T=
case `echo -n x` in #(((((
-n*)
@@ -510,6 +533,13 @@ case `echo -n x` in #(((((
ECHO_N='-n';;
esac
+# For backward compatibility with old third-party macros, we provide
+# the shell variables $as_echo and $as_echo_n. New code should use
+# AS_ECHO(["message"]) and AS_ECHO_N(["message"]), respectively.
+as_echo='printf %s\n'
+as_echo_n='printf %s'
+
+
rm -f conf$$ conf$$.exe conf$$.file
if test -d conf$$.dir; then
rm -f conf$$.dir/conf$$.file
@@ -577,53 +607,54 @@ MAKEFLAGS=
# Identity of this package.
PACKAGE_NAME='seedtool-cli'
PACKAGE_TARNAME='seedtool-cli'
-PACKAGE_VERSION='0.10.2'
-PACKAGE_STRING='seedtool-cli 0.10.2'
+PACKAGE_VERSION='0.11.0'
+PACKAGE_STRING='seedtool-cli 0.11.0'
PACKAGE_BUGREPORT=''
PACKAGE_URL=''
ac_unique_file="src/seedtool.cpp"
# Factoring default headers for most tests.
ac_includes_default="\
-#include
-#ifdef HAVE_SYS_TYPES_H
-# include
-#endif
-#ifdef HAVE_SYS_STAT_H
-# include
+#include
+#ifdef HAVE_STDIO_H
+# include
#endif
-#ifdef STDC_HEADERS
+#ifdef HAVE_STDLIB_H
# include
-# include
-#else
-# ifdef HAVE_STDLIB_H
-# include
-# endif
#endif
#ifdef HAVE_STRING_H
-# if !defined STDC_HEADERS && defined HAVE_MEMORY_H
-# include
-# endif
# include
#endif
-#ifdef HAVE_STRINGS_H
-# include
-#endif
#ifdef HAVE_INTTYPES_H
# include
#endif
#ifdef HAVE_STDINT_H
# include
#endif
+#ifdef HAVE_STRINGS_H
+# include
+#endif
+#ifdef HAVE_SYS_TYPES_H
+# include
+#endif
+#ifdef HAVE_SYS_STAT_H
+# include
+#endif
#ifdef HAVE_UNISTD_H
# include
#endif"
+ac_header_c_list=
ac_subst_vars='LTLIBOBJS
LIBOBJS
-EGREP
-GREP
-CPP
+host_os
+host_vendor
+host_cpu
+host
+build_os
+build_vendor
+build_cpu
+build
SET_MAKE
INSTALL_DATA
INSTALL_SCRIPT
@@ -691,8 +722,7 @@ LIBS
CPPFLAGS
CCC
CC
-CFLAGS
-CPP'
+CFLAGS'
# Initialize some variables set by options.
@@ -761,8 +791,6 @@ do
*) ac_optarg=yes ;;
esac
- # Accept the important Cygnus configure options, so we can diagnose typos.
-
case $ac_dashdash$ac_option in
--)
ac_dashdash=yes ;;
@@ -803,9 +831,9 @@ do
ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'`
# Reject names that are not valid shell variable names.
expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
- as_fn_error $? "invalid feature name: $ac_useropt"
+ as_fn_error $? "invalid feature name: \`$ac_useropt'"
ac_useropt_orig=$ac_useropt
- ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'`
case $ac_user_opts in
*"
"enable_$ac_useropt"
@@ -829,9 +857,9 @@ do
ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'`
# Reject names that are not valid shell variable names.
expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
- as_fn_error $? "invalid feature name: $ac_useropt"
+ as_fn_error $? "invalid feature name: \`$ac_useropt'"
ac_useropt_orig=$ac_useropt
- ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'`
case $ac_user_opts in
*"
"enable_$ac_useropt"
@@ -1042,9 +1070,9 @@ do
ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'`
# Reject names that are not valid shell variable names.
expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
- as_fn_error $? "invalid package name: $ac_useropt"
+ as_fn_error $? "invalid package name: \`$ac_useropt'"
ac_useropt_orig=$ac_useropt
- ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'`
case $ac_user_opts in
*"
"with_$ac_useropt"
@@ -1058,9 +1086,9 @@ do
ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'`
# Reject names that are not valid shell variable names.
expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null &&
- as_fn_error $? "invalid package name: $ac_useropt"
+ as_fn_error $? "invalid package name: \`$ac_useropt'"
ac_useropt_orig=$ac_useropt
- ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'`
+ ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'`
case $ac_user_opts in
*"
"with_$ac_useropt"
@@ -1104,9 +1132,9 @@ Try \`$0 --help' for more information"
*)
# FIXME: should be removed in autoconf 3.0.
- $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2
+ printf "%s\n" "$as_me: WARNING: you should use --build, --host, --target" >&2
expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null &&
- $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2
+ printf "%s\n" "$as_me: WARNING: invalid host type: $ac_option" >&2
: "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}"
;;
@@ -1122,7 +1150,7 @@ if test -n "$ac_unrecognized_opts"; then
case $enable_option_checking in
no) ;;
fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;;
- *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;;
+ *) printf "%s\n" "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;;
esac
fi
@@ -1186,7 +1214,7 @@ $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
X"$as_myself" : 'X\(//\)[^/]' \| \
X"$as_myself" : 'X\(//\)$' \| \
X"$as_myself" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X"$as_myself" |
+printf "%s\n" X"$as_myself" |
sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
s//\1/
q
@@ -1243,7 +1271,7 @@ if test "$ac_init_help" = "long"; then
# Omit some internal or obsolete options to make the list less imposing.
# This message is too long to be a string in the A/UX 3.1 sh.
cat <<_ACEOF
-\`configure' configures seedtool-cli 0.10.2 to adapt to many kinds of systems.
+\`configure' configures seedtool-cli 0.11.0 to adapt to many kinds of systems.
Usage: $0 [OPTION]... [VAR=VALUE]...
@@ -1300,12 +1328,16 @@ Fine tuning of the installation directories:
_ACEOF
cat <<\_ACEOF
+
+System types:
+ --build=BUILD configure for building on BUILD [guessed]
+ --host=HOST cross-compile to build programs to run on HOST [BUILD]
_ACEOF
fi
if test -n "$ac_init_help"; then
case $ac_init_help in
- short | recursive ) echo "Configuration of seedtool-cli 0.10.2:";;
+ short | recursive ) echo "Configuration of seedtool-cli 0.11.0:";;
esac
cat <<\_ACEOF
@@ -1319,7 +1351,6 @@ Some influential environment variables:
you have headers in a nonstandard directory
CC C compiler command
CFLAGS C compiler flags
- CPP C preprocessor
Use these variables to override the choices made by `configure' or to help
it to find libraries and programs with nonstandard names/locations.
@@ -1340,9 +1371,9 @@ if test "$ac_init_help" = "recursive"; then
case "$ac_dir" in
.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
*)
- ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+ ac_dir_suffix=/`printf "%s\n" "$ac_dir" | sed 's|^\.[\\/]||'`
# A ".." for each directory in $ac_dir_suffix.
- ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+ ac_top_builddir_sub=`printf "%s\n" "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
case $ac_top_builddir_sub in
"") ac_top_builddir_sub=. ac_top_build_prefix= ;;
*) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
@@ -1370,7 +1401,8 @@ esac
ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
cd "$ac_dir" || { ac_status=$?; continue; }
- # Check for guested configure.
+ # Check for configure.gnu first; this name is used for a wrapper for
+ # Metaconfig's "Configure" on case-insensitive file systems.
if test -f "$ac_srcdir/configure.gnu"; then
echo &&
$SHELL "$ac_srcdir/configure.gnu" --help=recursive
@@ -1378,7 +1410,7 @@ ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
echo &&
$SHELL "$ac_srcdir/configure" --help=recursive
else
- $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2
+ printf "%s\n" "$as_me: WARNING: no configuration information is in $ac_dir" >&2
fi || ac_status=$?
cd "$ac_pwd" || { ac_status=$?; break; }
done
@@ -1387,10 +1419,10 @@ fi
test -n "$ac_init_help" && exit $ac_status
if $ac_init_version; then
cat <<\_ACEOF
-seedtool-cli configure 0.10.2
-generated by GNU Autoconf 2.69
+seedtool-cli configure 0.11.0
+generated by GNU Autoconf 2.71
-Copyright (C) 2012 Free Software Foundation, Inc.
+Copyright (C) 2021 Free Software Foundation, Inc.
This configure script is free software; the Free Software Foundation
gives unlimited permission to copy, distribute and modify it.
_ACEOF
@@ -1407,14 +1439,14 @@ fi
ac_fn_cxx_try_compile ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- rm -f conftest.$ac_objext
+ rm -f conftest.$ac_objext conftest.beam
if { { ac_try="$ac_compile"
case "(($ac_try" in
*\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_compile") 2>conftest.err
ac_status=$?
if test -s conftest.err; then
@@ -1422,14 +1454,15 @@ $as_echo "$ac_try_echo"; } >&5
cat conftest.er1 >&5
mv -f conftest.er1 conftest.err
fi
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; } && {
test -z "$ac_cxx_werror_flag" ||
test ! -s conftest.err
- } && test -s conftest.$ac_objext; then :
+ } && test -s conftest.$ac_objext
+then :
ac_retval=0
-else
- $as_echo "$as_me: failed program was:" >&5
+else $as_nop
+ printf "%s\n" "$as_me: failed program was:" >&5
sed 's/^/| /' conftest.$ac_ext >&5
ac_retval=1
@@ -1445,14 +1478,14 @@ fi
ac_fn_c_try_compile ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- rm -f conftest.$ac_objext
+ rm -f conftest.$ac_objext conftest.beam
if { { ac_try="$ac_compile"
case "(($ac_try" in
*\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_compile") 2>conftest.err
ac_status=$?
if test -s conftest.err; then
@@ -1460,14 +1493,15 @@ $as_echo "$ac_try_echo"; } >&5
cat conftest.er1 >&5
mv -f conftest.er1 conftest.err
fi
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; } && {
test -z "$ac_c_werror_flag" ||
test ! -s conftest.err
- } && test -s conftest.$ac_objext; then :
+ } && test -s conftest.$ac_objext
+then :
ac_retval=0
-else
- $as_echo "$as_me: failed program was:" >&5
+else $as_nop
+ printf "%s\n" "$as_me: failed program was:" >&5
sed 's/^/| /' conftest.$ac_ext >&5
ac_retval=1
@@ -1483,14 +1517,14 @@ fi
ac_fn_c_try_link ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- rm -f conftest.$ac_objext conftest$ac_exeext
+ rm -f conftest.$ac_objext conftest.beam conftest$ac_exeext
if { { ac_try="$ac_link"
case "(($ac_try" in
*\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_link") 2>conftest.err
ac_status=$?
if test -s conftest.err; then
@@ -1498,17 +1532,18 @@ $as_echo "$ac_try_echo"; } >&5
cat conftest.er1 >&5
mv -f conftest.er1 conftest.err
fi
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; } && {
test -z "$ac_c_werror_flag" ||
test ! -s conftest.err
} && test -s conftest$ac_exeext && {
test "$cross_compiling" = yes ||
test -x conftest$ac_exeext
- }; then :
+ }
+then :
ac_retval=0
-else
- $as_echo "$as_me: failed program was:" >&5
+else $as_nop
+ printf "%s\n" "$as_me: failed program was:" >&5
sed 's/^/| /' conftest.$ac_ext >&5
ac_retval=1
@@ -1523,172 +1558,6 @@ fi
} # ac_fn_c_try_link
-# ac_fn_c_try_cpp LINENO
-# ----------------------
-# Try to preprocess conftest.$ac_ext, and return whether this succeeded.
-ac_fn_c_try_cpp ()
-{
- as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- if { { ac_try="$ac_cpp conftest.$ac_ext"
-case "(($ac_try" in
- *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
- *) ac_try_echo=$ac_try;;
-esac
-eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
- (eval "$ac_cpp conftest.$ac_ext") 2>conftest.err
- ac_status=$?
- if test -s conftest.err; then
- grep -v '^ *+' conftest.err >conftest.er1
- cat conftest.er1 >&5
- mv -f conftest.er1 conftest.err
- fi
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; } > conftest.i && {
- test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
- test ! -s conftest.err
- }; then :
- ac_retval=0
-else
- $as_echo "$as_me: failed program was:" >&5
-sed 's/^/| /' conftest.$ac_ext >&5
-
- ac_retval=1
-fi
- eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
- as_fn_set_status $ac_retval
-
-} # ac_fn_c_try_cpp
-
-# ac_fn_c_check_header_mongrel LINENO HEADER VAR INCLUDES
-# -------------------------------------------------------
-# Tests whether HEADER exists, giving a warning if it cannot be compiled using
-# the include files in INCLUDES and setting the cache variable VAR
-# accordingly.
-ac_fn_c_check_header_mongrel ()
-{
- as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- if eval \${$3+:} false; then :
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
-$as_echo_n "checking for $2... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-fi
-eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
-else
- # Is the header compilable?
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 usability" >&5
-$as_echo_n "checking $2 usability... " >&6; }
-cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-$4
-#include <$2>
-_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
- ac_header_compiler=yes
-else
- ac_header_compiler=no
-fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_compiler" >&5
-$as_echo "$ac_header_compiler" >&6; }
-
-# Is the header present?
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 presence" >&5
-$as_echo_n "checking $2 presence... " >&6; }
-cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include <$2>
-_ACEOF
-if ac_fn_c_try_cpp "$LINENO"; then :
- ac_header_preproc=yes
-else
- ac_header_preproc=no
-fi
-rm -f conftest.err conftest.i conftest.$ac_ext
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_preproc" >&5
-$as_echo "$ac_header_preproc" >&6; }
-
-# So? What about this header?
-case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in #((
- yes:no: )
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&5
-$as_echo "$as_me: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5
-$as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;}
- ;;
- no:yes:* )
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: present but cannot be compiled" >&5
-$as_echo "$as_me: WARNING: $2: present but cannot be compiled" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: check for missing prerequisite headers?" >&5
-$as_echo "$as_me: WARNING: $2: check for missing prerequisite headers?" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: see the Autoconf documentation" >&5
-$as_echo "$as_me: WARNING: $2: see the Autoconf documentation" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&5
-$as_echo "$as_me: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5
-$as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;}
- ;;
-esac
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
-$as_echo_n "checking for $2... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- eval "$3=\$ac_header_compiler"
-fi
-eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
-fi
- eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
-
-} # ac_fn_c_check_header_mongrel
-
-# ac_fn_c_try_run LINENO
-# ----------------------
-# Try to link conftest.$ac_ext, and return whether this succeeded. Assumes
-# that executables *can* be run.
-ac_fn_c_try_run ()
-{
- as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- if { { ac_try="$ac_link"
-case "(($ac_try" in
- *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
- *) ac_try_echo=$ac_try;;
-esac
-eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
- (eval "$ac_link") 2>&5
- ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; } && { ac_try='./conftest$ac_exeext'
- { { case "(($ac_try" in
- *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
- *) ac_try_echo=$ac_try;;
-esac
-eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
- (eval "$ac_try") 2>&5
- ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; }; }; then :
- ac_retval=0
-else
- $as_echo "$as_me: program exited with status $ac_status" >&5
- $as_echo "$as_me: failed program was:" >&5
-sed 's/^/| /' conftest.$ac_ext >&5
-
- ac_retval=$ac_status
-fi
- rm -rf conftest.dSYM conftest_ipa8_conftest.oo
- eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
- as_fn_set_status $ac_retval
-
-} # ac_fn_c_try_run
-
# ac_fn_c_check_header_compile LINENO HEADER VAR INCLUDES
# -------------------------------------------------------
# Tests whether HEADER exists and can be compiled using the include files in
@@ -1696,26 +1565,28 @@ fi
ac_fn_c_check_header_compile ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
-$as_echo_n "checking for $2... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
+printf %s "checking for $2... " >&6; }
+if eval test \${$3+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
$4
#include <$2>
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
eval "$3=yes"
-else
+else $as_nop
eval "$3=no"
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
+printf "%s\n" "$ac_res" >&6; }
eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
} # ac_fn_c_check_header_compile
@@ -1727,17 +1598,18 @@ $as_echo "$ac_res" >&6; }
ac_fn_c_check_type ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
-$as_echo_n "checking for $2... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
+printf %s "checking for $2... " >&6; }
+if eval test \${$3+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
eval "$3=no"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
$4
int
-main ()
+main (void)
{
if (sizeof ($2))
return 0;
@@ -1745,12 +1617,13 @@ if (sizeof ($2))
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
$4
int
-main ()
+main (void)
{
if (sizeof (($2)))
return 0;
@@ -1758,18 +1631,19 @@ if (sizeof (($2)))
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
-else
+else $as_nop
eval "$3=yes"
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
+printf "%s\n" "$ac_res" >&6; }
eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
} # ac_fn_c_check_type
@@ -1781,11 +1655,12 @@ $as_echo "$ac_res" >&6; }
ac_fn_c_find_uintX_t ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for uint$2_t" >&5
-$as_echo_n "checking for uint$2_t... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for uint$2_t" >&5
+printf %s "checking for uint$2_t... " >&6; }
+if eval test \${$3+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
eval "$3=no"
# Order is important - never check a type that is potentially smaller
# than half of the expected target width.
@@ -1795,7 +1670,7 @@ else
/* end confdefs.h. */
$ac_includes_default
int
-main ()
+main (void)
{
static int test_array [1 - 2 * !((($ac_type) -1 >> ($2 / 2 - 1)) >> ($2 / 2 - 1) == 3)];
test_array [0] = 0;
@@ -1805,7 +1680,8 @@ return test_array [0];
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
case $ac_type in #(
uint$2_t) :
eval "$3=yes" ;; #(
@@ -1813,17 +1689,18 @@ if ac_fn_c_try_compile "$LINENO"; then :
eval "$3=\$ac_type" ;;
esac
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
- if eval test \"x\$"$3"\" = x"no"; then :
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
+ if eval test \"x\$"$3"\" = x"no"
+then :
-else
+else $as_nop
break
fi
done
fi
eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
+printf "%s\n" "$ac_res" >&6; }
eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
} # ac_fn_c_find_uintX_t
@@ -1835,11 +1712,12 @@ $as_echo "$ac_res" >&6; }
ac_fn_c_find_intX_t ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for int$2_t" >&5
-$as_echo_n "checking for int$2_t... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for int$2_t" >&5
+printf %s "checking for int$2_t... " >&6; }
+if eval test \${$3+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
eval "$3=no"
# Order is important - never check a type that is potentially smaller
# than half of the expected target width.
@@ -1850,7 +1728,7 @@ else
$ac_includes_default
enum { N = $2 / 2 - 1 };
int
-main ()
+main (void)
{
static int test_array [1 - 2 * !(0 < ($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 1))];
test_array [0] = 0;
@@ -1860,13 +1738,14 @@ return test_array [0];
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
$ac_includes_default
enum { N = $2 / 2 - 1 };
int
-main ()
+main (void)
{
static int test_array [1 - 2 * !(($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 1)
< ($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 2))];
@@ -1877,9 +1756,10 @@ return test_array [0];
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
-else
+else $as_nop
case $ac_type in #(
int$2_t) :
eval "$3=yes" ;; #(
@@ -1887,34 +1767,79 @@ else
eval "$3=\$ac_type" ;;
esac
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
- if eval test \"x\$"$3"\" = x"no"; then :
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
+ if eval test \"x\$"$3"\" = x"no"
+then :
-else
+else $as_nop
break
fi
done
fi
eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
+printf "%s\n" "$ac_res" >&6; }
eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
} # ac_fn_c_find_intX_t
+# ac_fn_c_try_run LINENO
+# ----------------------
+# Try to run conftest.$ac_ext, and return whether this succeeded. Assumes that
+# executables *can* be run.
+ac_fn_c_try_run ()
+{
+ as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
+ if { { ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
+printf "%s\n" "$ac_try_echo"; } >&5
+ (eval "$ac_link") 2>&5
+ ac_status=$?
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ test $ac_status = 0; } && { ac_try='./conftest$ac_exeext'
+ { { case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
+printf "%s\n" "$ac_try_echo"; } >&5
+ (eval "$ac_try") 2>&5
+ ac_status=$?
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ test $ac_status = 0; }; }
+then :
+ ac_retval=0
+else $as_nop
+ printf "%s\n" "$as_me: program exited with status $ac_status" >&5
+ printf "%s\n" "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_retval=$ac_status
+fi
+ rm -rf conftest.dSYM conftest_ipa8_conftest.oo
+ eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
+ as_fn_set_status $ac_retval
+
+} # ac_fn_c_try_run
+
# ac_fn_c_check_func LINENO FUNC VAR
# ----------------------------------
# Tests whether FUNC exists, setting the cache variable VAR accordingly
ac_fn_c_check_func ()
{
as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
-$as_echo_n "checking for $2... " >&6; }
-if eval \${$3+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5
+printf %s "checking for $2... " >&6; }
+if eval test \${$3+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
/* Define $2 to an innocuous variant, in case declares $2.
@@ -1922,16 +1847,9 @@ else
#define $2 innocuous_$2
/* System header to define __stub macros and hopefully few prototypes,
- which can conflict with char $2 (); below.
- Prefer to if __STDC__ is defined, since
- exists even on freestanding compilers. */
-
-#ifdef __STDC__
-# include
-#else
-# include
-#endif
+ which can conflict with char $2 (); below. */
+#include
#undef $2
/* Override any GCC internal prototype to avoid an error.
@@ -1949,35 +1867,56 @@ choke me
#endif
int
-main ()
+main (void)
{
return $2 ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
eval "$3=yes"
-else
+else $as_nop
eval "$3=no"
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
fi
eval ac_res=\$$3
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
-$as_echo "$ac_res" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5
+printf "%s\n" "$ac_res" >&6; }
eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno
} # ac_fn_c_check_func
+ac_configure_args_raw=
+for ac_arg
+do
+ case $ac_arg in
+ *\'*)
+ ac_arg=`printf "%s\n" "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ esac
+ as_fn_append ac_configure_args_raw " '$ac_arg'"
+done
+
+case $ac_configure_args_raw in
+ *$as_nl*)
+ ac_safe_unquote= ;;
+ *)
+ ac_unsafe_z='|&;<>()$`\\"*?[ '' ' # This string ends in space, tab.
+ ac_unsafe_a="$ac_unsafe_z#~"
+ ac_safe_unquote="s/ '\\([^$ac_unsafe_a][^$ac_unsafe_z]*\\)'/ \\1/g"
+ ac_configure_args_raw=` printf "%s\n" "$ac_configure_args_raw" | sed "$ac_safe_unquote"`;;
+esac
+
cat >config.log <<_ACEOF
This file contains any messages produced by compilers while
running configure, to aid debugging if configure makes a mistake.
-It was created by seedtool-cli $as_me 0.10.2, which was
-generated by GNU Autoconf 2.69. Invocation command line was
+It was created by seedtool-cli $as_me 0.11.0, which was
+generated by GNU Autoconf 2.71. Invocation command line was
- $ $0 $@
+ $ $0$ac_configure_args_raw
_ACEOF
exec 5>>config.log
@@ -2010,8 +1949,12 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- $as_echo "PATH: $as_dir"
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ printf "%s\n" "PATH: $as_dir"
done
IFS=$as_save_IFS
@@ -2046,7 +1989,7 @@ do
| -silent | --silent | --silen | --sile | --sil)
continue ;;
*\'*)
- ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ ac_arg=`printf "%s\n" "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
esac
case $ac_pass in
1) as_fn_append ac_configure_args0 " '$ac_arg'" ;;
@@ -2081,11 +2024,13 @@ done
# WARNING: Use '\'' to represent an apostrophe within the trap.
# WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug.
trap 'exit_status=$?
+ # Sanitize IFS.
+ IFS=" "" $as_nl"
# Save into config.log some information that might help in debugging.
{
echo
- $as_echo "## ---------------- ##
+ printf "%s\n" "## ---------------- ##
## Cache variables. ##
## ---------------- ##"
echo
@@ -2096,8 +2041,8 @@ trap 'exit_status=$?
case $ac_val in #(
*${as_nl}*)
case $ac_var in #(
- *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
-$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+ *_cv_*) { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+printf "%s\n" "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
esac
case $ac_var in #(
_ | IFS | as_nl) ;; #(
@@ -2121,7 +2066,7 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
)
echo
- $as_echo "## ----------------- ##
+ printf "%s\n" "## ----------------- ##
## Output variables. ##
## ----------------- ##"
echo
@@ -2129,14 +2074,14 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
do
eval ac_val=\$$ac_var
case $ac_val in
- *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ *\'\''*) ac_val=`printf "%s\n" "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
esac
- $as_echo "$ac_var='\''$ac_val'\''"
+ printf "%s\n" "$ac_var='\''$ac_val'\''"
done | sort
echo
if test -n "$ac_subst_files"; then
- $as_echo "## ------------------- ##
+ printf "%s\n" "## ------------------- ##
## File substitutions. ##
## ------------------- ##"
echo
@@ -2144,15 +2089,15 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
do
eval ac_val=\$$ac_var
case $ac_val in
- *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ *\'\''*) ac_val=`printf "%s\n" "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
esac
- $as_echo "$ac_var='\''$ac_val'\''"
+ printf "%s\n" "$ac_var='\''$ac_val'\''"
done | sort
echo
fi
if test -s confdefs.h; then
- $as_echo "## ----------- ##
+ printf "%s\n" "## ----------- ##
## confdefs.h. ##
## ----------- ##"
echo
@@ -2160,8 +2105,8 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
echo
fi
test "$ac_signal" != 0 &&
- $as_echo "$as_me: caught signal $ac_signal"
- $as_echo "$as_me: exit $exit_status"
+ printf "%s\n" "$as_me: caught signal $ac_signal"
+ printf "%s\n" "$as_me: exit $exit_status"
} >&5
rm -f core *.core core.conftest.* &&
rm -f -r conftest* confdefs* conf$$* $ac_clean_files &&
@@ -2175,63 +2120,48 @@ ac_signal=0
# confdefs.h avoids OS command line length limits that DEFS can exceed.
rm -f -r conftest* confdefs.h
-$as_echo "/* confdefs.h */" > confdefs.h
+printf "%s\n" "/* confdefs.h */" > confdefs.h
# Predefined preprocessor variables.
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_NAME "$PACKAGE_NAME"
-_ACEOF
+printf "%s\n" "#define PACKAGE_NAME \"$PACKAGE_NAME\"" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_TARNAME "$PACKAGE_TARNAME"
-_ACEOF
+printf "%s\n" "#define PACKAGE_TARNAME \"$PACKAGE_TARNAME\"" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_VERSION "$PACKAGE_VERSION"
-_ACEOF
+printf "%s\n" "#define PACKAGE_VERSION \"$PACKAGE_VERSION\"" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_STRING "$PACKAGE_STRING"
-_ACEOF
+printf "%s\n" "#define PACKAGE_STRING \"$PACKAGE_STRING\"" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT"
-_ACEOF
+printf "%s\n" "#define PACKAGE_BUGREPORT \"$PACKAGE_BUGREPORT\"" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define PACKAGE_URL "$PACKAGE_URL"
-_ACEOF
+printf "%s\n" "#define PACKAGE_URL \"$PACKAGE_URL\"" >>confdefs.h
# Let the site file select an alternate cache file if it wants to.
# Prefer an explicitly selected file to automatically selected ones.
-ac_site_file1=NONE
-ac_site_file2=NONE
if test -n "$CONFIG_SITE"; then
- # We do not want a PATH search for config.site.
- case $CONFIG_SITE in #((
- -*) ac_site_file1=./$CONFIG_SITE;;
- */*) ac_site_file1=$CONFIG_SITE;;
- *) ac_site_file1=./$CONFIG_SITE;;
- esac
+ ac_site_files="$CONFIG_SITE"
elif test "x$prefix" != xNONE; then
- ac_site_file1=$prefix/share/config.site
- ac_site_file2=$prefix/etc/config.site
+ ac_site_files="$prefix/share/config.site $prefix/etc/config.site"
else
- ac_site_file1=$ac_default_prefix/share/config.site
- ac_site_file2=$ac_default_prefix/etc/config.site
+ ac_site_files="$ac_default_prefix/share/config.site $ac_default_prefix/etc/config.site"
fi
-for ac_site_file in "$ac_site_file1" "$ac_site_file2"
+
+for ac_site_file in $ac_site_files
do
- test "x$ac_site_file" = xNONE && continue
- if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5
-$as_echo "$as_me: loading site script $ac_site_file" >&6;}
+ case $ac_site_file in #(
+ */*) :
+ ;; #(
+ *) :
+ ac_site_file=./$ac_site_file ;;
+esac
+ if test -f "$ac_site_file" && test -r "$ac_site_file"; then
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5
+printf "%s\n" "$as_me: loading site script $ac_site_file" >&6;}
sed 's/^/| /' "$ac_site_file" >&5
. "$ac_site_file" \
- || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+ || { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
as_fn_error $? "failed to load site script $ac_site_file
See \`config.log' for more details" "$LINENO" 5; }
fi
@@ -2241,61 +2171,692 @@ if test -r "$cache_file"; then
# Some versions of bash will fail to source /dev/null (special files
# actually), so we avoid doing that. DJGPP emulates it as a regular file.
if test /dev/null != "$cache_file" && test -f "$cache_file"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5
-$as_echo "$as_me: loading cache $cache_file" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5
+printf "%s\n" "$as_me: loading cache $cache_file" >&6;}
case $cache_file in
[\\/]* | ?:[\\/]* ) . "$cache_file";;
*) . "./$cache_file";;
esac
fi
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5
-$as_echo "$as_me: creating cache $cache_file" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5
+printf "%s\n" "$as_me: creating cache $cache_file" >&6;}
>$cache_file
fi
-# Check that the precious variables saved in the cache have kept the same
-# value.
-ac_cache_corrupted=false
-for ac_var in $ac_precious_vars; do
- eval ac_old_set=\$ac_cv_env_${ac_var}_set
- eval ac_new_set=\$ac_env_${ac_var}_set
- eval ac_old_val=\$ac_cv_env_${ac_var}_value
- eval ac_new_val=\$ac_env_${ac_var}_value
- case $ac_old_set,$ac_new_set in
- set,)
- { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
-$as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
- ac_cache_corrupted=: ;;
- ,set)
- { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5
-$as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
- ac_cache_corrupted=: ;;
- ,);;
- *)
- if test "x$ac_old_val" != "x$ac_new_val"; then
- # differences in whitespace do not lead to failure.
- ac_old_val_w=`echo x $ac_old_val`
- ac_new_val_w=`echo x $ac_new_val`
- if test "$ac_old_val_w" != "$ac_new_val_w"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5
-$as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
- ac_cache_corrupted=:
- else
- { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5
-$as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;}
- eval $ac_var=\$ac_old_val
+# Test code for whether the C++ compiler supports C++98 (global declarations)
+ac_cxx_conftest_cxx98_globals='
+// Does the compiler advertise C++98 conformance?
+#if !defined __cplusplus || __cplusplus < 199711L
+# error "Compiler does not advertise C++98 conformance"
+#endif
+
+// These inclusions are to reject old compilers that
+// lack the unsuffixed header files.
+#include
+#include
+
+// and are *not* freestanding headers in C++98.
+extern void assert (int);
+namespace std {
+ extern int strcmp (const char *, const char *);
+}
+
+// Namespaces, exceptions, and templates were all added after "C++ 2.0".
+using std::exception;
+using std::strcmp;
+
+namespace {
+
+void test_exception_syntax()
+{
+ try {
+ throw "test";
+ } catch (const char *s) {
+ // Extra parentheses suppress a warning when building autoconf itself,
+ // due to lint rules shared with more typical C programs.
+ assert (!(strcmp) (s, "test"));
+ }
+}
+
+template struct test_template
+{
+ T const val;
+ explicit test_template(T t) : val(t) {}
+ template T add(U u) { return static_cast(u) + val; }
+};
+
+} // anonymous namespace
+'
+
+# Test code for whether the C++ compiler supports C++98 (body of main)
+ac_cxx_conftest_cxx98_main='
+ assert (argc);
+ assert (! argv[0]);
+{
+ test_exception_syntax ();
+ test_template tt (2.0);
+ assert (tt.add (4) == 6.0);
+ assert (true && !false);
+}
+'
+
+# Test code for whether the C++ compiler supports C++11 (global declarations)
+ac_cxx_conftest_cxx11_globals='
+// Does the compiler advertise C++ 2011 conformance?
+#if !defined __cplusplus || __cplusplus < 201103L
+# error "Compiler does not advertise C++11 conformance"
+#endif
+
+namespace cxx11test
+{
+ constexpr int get_val() { return 20; }
+
+ struct testinit
+ {
+ int i;
+ double d;
+ };
+
+ class delegate
+ {
+ public:
+ delegate(int n) : n(n) {}
+ delegate(): delegate(2354) {}
+
+ virtual int getval() { return this->n; };
+ protected:
+ int n;
+ };
+
+ class overridden : public delegate
+ {
+ public:
+ overridden(int n): delegate(n) {}
+ virtual int getval() override final { return this->n * 2; }
+ };
+
+ class nocopy
+ {
+ public:
+ nocopy(int i): i(i) {}
+ nocopy() = default;
+ nocopy(const nocopy&) = delete;
+ nocopy & operator=(const nocopy&) = delete;
+ private:
+ int i;
+ };
+
+ // for testing lambda expressions
+ template Ret eval(Fn f, Ret v)
+ {
+ return f(v);
+ }
+
+ // for testing variadic templates and trailing return types
+ template auto sum(V first) -> V
+ {
+ return first;
+ }
+ template auto sum(V first, Args... rest) -> V
+ {
+ return first + sum(rest...);
+ }
+}
+'
+
+# Test code for whether the C++ compiler supports C++11 (body of main)
+ac_cxx_conftest_cxx11_main='
+{
+ // Test auto and decltype
+ auto a1 = 6538;
+ auto a2 = 48573953.4;
+ auto a3 = "String literal";
+
+ int total = 0;
+ for (auto i = a3; *i; ++i) { total += *i; }
+
+ decltype(a2) a4 = 34895.034;
+}
+{
+ // Test constexpr
+ short sa[cxx11test::get_val()] = { 0 };
+}
+{
+ // Test initializer lists
+ cxx11test::testinit il = { 4323, 435234.23544 };
+}
+{
+ // Test range-based for
+ int array[] = {9, 7, 13, 15, 4, 18, 12, 10, 5, 3,
+ 14, 19, 17, 8, 6, 20, 16, 2, 11, 1};
+ for (auto &x : array) { x += 23; }
+}
+{
+ // Test lambda expressions
+ using cxx11test::eval;
+ assert (eval ([](int x) { return x*2; }, 21) == 42);
+ double d = 2.0;
+ assert (eval ([&](double x) { return d += x; }, 3.0) == 5.0);
+ assert (d == 5.0);
+ assert (eval ([=](double x) mutable { return d += x; }, 4.0) == 9.0);
+ assert (d == 5.0);
+}
+{
+ // Test use of variadic templates
+ using cxx11test::sum;
+ auto a = sum(1);
+ auto b = sum(1, 2);
+ auto c = sum(1.0, 2.0, 3.0);
+}
+{
+ // Test constructor delegation
+ cxx11test::delegate d1;
+ cxx11test::delegate d2();
+ cxx11test::delegate d3(45);
+}
+{
+ // Test override and final
+ cxx11test::overridden o1(55464);
+}
+{
+ // Test nullptr
+ char *c = nullptr;
+}
+{
+ // Test template brackets
+ test_template<::test_template> v(test_template(12));
+}
+{
+ // Unicode literals
+ char const *utf8 = u8"UTF-8 string \u2500";
+ char16_t const *utf16 = u"UTF-8 string \u2500";
+ char32_t const *utf32 = U"UTF-32 string \u2500";
+}
+'
+
+# Test code for whether the C compiler supports C++11 (complete).
+ac_cxx_conftest_cxx11_program="${ac_cxx_conftest_cxx98_globals}
+${ac_cxx_conftest_cxx11_globals}
+
+int
+main (int argc, char **argv)
+{
+ int ok = 0;
+ ${ac_cxx_conftest_cxx98_main}
+ ${ac_cxx_conftest_cxx11_main}
+ return ok;
+}
+"
+
+# Test code for whether the C compiler supports C++98 (complete).
+ac_cxx_conftest_cxx98_program="${ac_cxx_conftest_cxx98_globals}
+int
+main (int argc, char **argv)
+{
+ int ok = 0;
+ ${ac_cxx_conftest_cxx98_main}
+ return ok;
+}
+"
+
+# Test code for whether the C compiler supports C89 (global declarations)
+ac_c_conftest_c89_globals='
+/* Does the compiler advertise C89 conformance?
+ Do not test the value of __STDC__, because some compilers set it to 0
+ while being otherwise adequately conformant. */
+#if !defined __STDC__
+# error "Compiler does not advertise C89 conformance"
+#endif
+
+#include
+#include
+struct stat;
+/* Most of the following tests are stolen from RCS 5.7 src/conf.sh. */
+struct buf { int x; };
+struct buf * (*rcsopen) (struct buf *, struct stat *, int);
+static char *e (p, i)
+ char **p;
+ int i;
+{
+ return p[i];
+}
+static char *f (char * (*g) (char **, int), char **p, ...)
+{
+ char *s;
+ va_list v;
+ va_start (v,p);
+ s = g (p, va_arg (v,int));
+ va_end (v);
+ return s;
+}
+
+/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has
+ function prototypes and stuff, but not \xHH hex character constants.
+ These do not provoke an error unfortunately, instead are silently treated
+ as an "x". The following induces an error, until -std is added to get
+ proper ANSI mode. Curiously \x00 != x always comes out true, for an
+ array size at least. It is necessary to write \x00 == 0 to get something
+ that is true only with -std. */
+int osf4_cc_array ['\''\x00'\'' == 0 ? 1 : -1];
+
+/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters
+ inside strings and character constants. */
+#define FOO(x) '\''x'\''
+int xlc6_cc_array[FOO(a) == '\''x'\'' ? 1 : -1];
+
+int test (int i, double x);
+struct s1 {int (*f) (int a);};
+struct s2 {int (*f) (double a);};
+int pairnames (int, char **, int *(*)(struct buf *, struct stat *, int),
+ int, int);'
+
+# Test code for whether the C compiler supports C89 (body of main).
+ac_c_conftest_c89_main='
+ok |= (argc == 0 || f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]);
+'
+
+# Test code for whether the C compiler supports C99 (global declarations)
+ac_c_conftest_c99_globals='
+// Does the compiler advertise C99 conformance?
+#if !defined __STDC_VERSION__ || __STDC_VERSION__ < 199901L
+# error "Compiler does not advertise C99 conformance"
+#endif
+
+#include
+extern int puts (const char *);
+extern int printf (const char *, ...);
+extern int dprintf (int, const char *, ...);
+extern void *malloc (size_t);
+
+// Check varargs macros. These examples are taken from C99 6.10.3.5.
+// dprintf is used instead of fprintf to avoid needing to declare
+// FILE and stderr.
+#define debug(...) dprintf (2, __VA_ARGS__)
+#define showlist(...) puts (#__VA_ARGS__)
+#define report(test,...) ((test) ? puts (#test) : printf (__VA_ARGS__))
+static void
+test_varargs_macros (void)
+{
+ int x = 1234;
+ int y = 5678;
+ debug ("Flag");
+ debug ("X = %d\n", x);
+ showlist (The first, second, and third items.);
+ report (x>y, "x is %d but y is %d", x, y);
+}
+
+// Check long long types.
+#define BIG64 18446744073709551615ull
+#define BIG32 4294967295ul
+#define BIG_OK (BIG64 / BIG32 == 4294967297ull && BIG64 % BIG32 == 0)
+#if !BIG_OK
+ #error "your preprocessor is broken"
+#endif
+#if BIG_OK
+#else
+ #error "your preprocessor is broken"
+#endif
+static long long int bignum = -9223372036854775807LL;
+static unsigned long long int ubignum = BIG64;
+
+struct incomplete_array
+{
+ int datasize;
+ double data[];
+};
+
+struct named_init {
+ int number;
+ const wchar_t *name;
+ double average;
+};
+
+typedef const char *ccp;
+
+static inline int
+test_restrict (ccp restrict text)
+{
+ // See if C++-style comments work.
+ // Iterate through items via the restricted pointer.
+ // Also check for declarations in for loops.
+ for (unsigned int i = 0; *(text+i) != '\''\0'\''; ++i)
+ continue;
+ return 0;
+}
+
+// Check varargs and va_copy.
+static bool
+test_varargs (const char *format, ...)
+{
+ va_list args;
+ va_start (args, format);
+ va_list args_copy;
+ va_copy (args_copy, args);
+
+ const char *str = "";
+ int number = 0;
+ float fnumber = 0;
+
+ while (*format)
+ {
+ switch (*format++)
+ {
+ case '\''s'\'': // string
+ str = va_arg (args_copy, const char *);
+ break;
+ case '\''d'\'': // int
+ number = va_arg (args_copy, int);
+ break;
+ case '\''f'\'': // float
+ fnumber = va_arg (args_copy, double);
+ break;
+ default:
+ break;
+ }
+ }
+ va_end (args_copy);
+ va_end (args);
+
+ return *str && number && fnumber;
+}
+'
+
+# Test code for whether the C compiler supports C99 (body of main).
+ac_c_conftest_c99_main='
+ // Check bool.
+ _Bool success = false;
+ success |= (argc != 0);
+
+ // Check restrict.
+ if (test_restrict ("String literal") == 0)
+ success = true;
+ char *restrict newvar = "Another string";
+
+ // Check varargs.
+ success &= test_varargs ("s, d'\'' f .", "string", 65, 34.234);
+ test_varargs_macros ();
+
+ // Check flexible array members.
+ struct incomplete_array *ia =
+ malloc (sizeof (struct incomplete_array) + (sizeof (double) * 10));
+ ia->datasize = 10;
+ for (int i = 0; i < ia->datasize; ++i)
+ ia->data[i] = i * 1.234;
+
+ // Check named initializers.
+ struct named_init ni = {
+ .number = 34,
+ .name = L"Test wide string",
+ .average = 543.34343,
+ };
+
+ ni.number = 58;
+
+ int dynamic_array[ni.number];
+ dynamic_array[0] = argv[0][0];
+ dynamic_array[ni.number - 1] = 543;
+
+ // work around unused variable warnings
+ ok |= (!success || bignum == 0LL || ubignum == 0uLL || newvar[0] == '\''x'\''
+ || dynamic_array[ni.number - 1] != 543);
+'
+
+# Test code for whether the C compiler supports C11 (global declarations)
+ac_c_conftest_c11_globals='
+// Does the compiler advertise C11 conformance?
+#if !defined __STDC_VERSION__ || __STDC_VERSION__ < 201112L
+# error "Compiler does not advertise C11 conformance"
+#endif
+
+// Check _Alignas.
+char _Alignas (double) aligned_as_double;
+char _Alignas (0) no_special_alignment;
+extern char aligned_as_int;
+char _Alignas (0) _Alignas (int) aligned_as_int;
+
+// Check _Alignof.
+enum
+{
+ int_alignment = _Alignof (int),
+ int_array_alignment = _Alignof (int[100]),
+ char_alignment = _Alignof (char)
+};
+_Static_assert (0 < -_Alignof (int), "_Alignof is signed");
+
+// Check _Noreturn.
+int _Noreturn does_not_return (void) { for (;;) continue; }
+
+// Check _Static_assert.
+struct test_static_assert
+{
+ int x;
+ _Static_assert (sizeof (int) <= sizeof (long int),
+ "_Static_assert does not work in struct");
+ long int y;
+};
+
+// Check UTF-8 literals.
+#define u8 syntax error!
+char const utf8_literal[] = u8"happens to be ASCII" "another string";
+
+// Check duplicate typedefs.
+typedef long *long_ptr;
+typedef long int *long_ptr;
+typedef long_ptr long_ptr;
+
+// Anonymous structures and unions -- taken from C11 6.7.2.1 Example 1.
+struct anonymous
+{
+ union {
+ struct { int i; int j; };
+ struct { int k; long int l; } w;
+ };
+ int m;
+} v1;
+'
+
+# Test code for whether the C compiler supports C11 (body of main).
+ac_c_conftest_c11_main='
+ _Static_assert ((offsetof (struct anonymous, i)
+ == offsetof (struct anonymous, w.k)),
+ "Anonymous union alignment botch");
+ v1.i = 2;
+ v1.w.k = 5;
+ ok |= v1.i != 5;
+'
+
+# Test code for whether the C compiler supports C11 (complete).
+ac_c_conftest_c11_program="${ac_c_conftest_c89_globals}
+${ac_c_conftest_c99_globals}
+${ac_c_conftest_c11_globals}
+
+int
+main (int argc, char **argv)
+{
+ int ok = 0;
+ ${ac_c_conftest_c89_main}
+ ${ac_c_conftest_c99_main}
+ ${ac_c_conftest_c11_main}
+ return ok;
+}
+"
+
+# Test code for whether the C compiler supports C99 (complete).
+ac_c_conftest_c99_program="${ac_c_conftest_c89_globals}
+${ac_c_conftest_c99_globals}
+
+int
+main (int argc, char **argv)
+{
+ int ok = 0;
+ ${ac_c_conftest_c89_main}
+ ${ac_c_conftest_c99_main}
+ return ok;
+}
+"
+
+# Test code for whether the C compiler supports C89 (complete).
+ac_c_conftest_c89_program="${ac_c_conftest_c89_globals}
+
+int
+main (int argc, char **argv)
+{
+ int ok = 0;
+ ${ac_c_conftest_c89_main}
+ return ok;
+}
+"
+
+as_fn_append ac_header_c_list " stdio.h stdio_h HAVE_STDIO_H"
+as_fn_append ac_header_c_list " stdlib.h stdlib_h HAVE_STDLIB_H"
+as_fn_append ac_header_c_list " string.h string_h HAVE_STRING_H"
+as_fn_append ac_header_c_list " inttypes.h inttypes_h HAVE_INTTYPES_H"
+as_fn_append ac_header_c_list " stdint.h stdint_h HAVE_STDINT_H"
+as_fn_append ac_header_c_list " strings.h strings_h HAVE_STRINGS_H"
+as_fn_append ac_header_c_list " sys/stat.h sys_stat_h HAVE_SYS_STAT_H"
+as_fn_append ac_header_c_list " sys/types.h sys_types_h HAVE_SYS_TYPES_H"
+as_fn_append ac_header_c_list " unistd.h unistd_h HAVE_UNISTD_H"
+
+# Auxiliary files required by this configure script.
+ac_aux_files="config.guess config.sub install-sh"
+
+# Locations in which to look for auxiliary files.
+ac_aux_dir_candidates="${srcdir}/build-aux"
+
+# Search for a directory containing all of the required auxiliary files,
+# $ac_aux_files, from the $PATH-style list $ac_aux_dir_candidates.
+# If we don't find one directory that contains all the files we need,
+# we report the set of missing files from the *first* directory in
+# $ac_aux_dir_candidates and give up.
+ac_missing_aux_files=""
+ac_first_candidate=:
+printf "%s\n" "$as_me:${as_lineno-$LINENO}: looking for aux files: $ac_aux_files" >&5
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+as_found=false
+for as_dir in $ac_aux_dir_candidates
+do
+ IFS=$as_save_IFS
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ as_found=:
+
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: trying $as_dir" >&5
+ ac_aux_dir_found=yes
+ ac_install_sh=
+ for ac_aux in $ac_aux_files
+ do
+ # As a special case, if "install-sh" is required, that requirement
+ # can be satisfied by any of "install-sh", "install.sh", or "shtool",
+ # and $ac_install_sh is set appropriately for whichever one is found.
+ if test x"$ac_aux" = x"install-sh"
+ then
+ if test -f "${as_dir}install-sh"; then
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}install-sh found" >&5
+ ac_install_sh="${as_dir}install-sh -c"
+ elif test -f "${as_dir}install.sh"; then
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}install.sh found" >&5
+ ac_install_sh="${as_dir}install.sh -c"
+ elif test -f "${as_dir}shtool"; then
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}shtool found" >&5
+ ac_install_sh="${as_dir}shtool install -c"
+ else
+ ac_aux_dir_found=no
+ if $ac_first_candidate; then
+ ac_missing_aux_files="${ac_missing_aux_files} install-sh"
+ else
+ break
+ fi
+ fi
+ else
+ if test -f "${as_dir}${ac_aux}"; then
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}${ac_aux} found" >&5
+ else
+ ac_aux_dir_found=no
+ if $ac_first_candidate; then
+ ac_missing_aux_files="${ac_missing_aux_files} ${ac_aux}"
+ else
+ break
+ fi
+ fi
+ fi
+ done
+ if test "$ac_aux_dir_found" = yes; then
+ ac_aux_dir="$as_dir"
+ break
+ fi
+ ac_first_candidate=false
+
+ as_found=false
+done
+IFS=$as_save_IFS
+if $as_found
+then :
+
+else $as_nop
+ as_fn_error $? "cannot find required auxiliary files:$ac_missing_aux_files" "$LINENO" 5
+fi
+
+
+# These three variables are undocumented and unsupported,
+# and are intended to be withdrawn in a future Autoconf release.
+# They can cause serious problems if a builder's source tree is in a directory
+# whose full name contains unusual characters.
+if test -f "${ac_aux_dir}config.guess"; then
+ ac_config_guess="$SHELL ${ac_aux_dir}config.guess"
+fi
+if test -f "${ac_aux_dir}config.sub"; then
+ ac_config_sub="$SHELL ${ac_aux_dir}config.sub"
+fi
+if test -f "$ac_aux_dir/configure"; then
+ ac_configure="$SHELL ${ac_aux_dir}configure"
+fi
+
+# Check that the precious variables saved in the cache have kept the same
+# value.
+ac_cache_corrupted=false
+for ac_var in $ac_precious_vars; do
+ eval ac_old_set=\$ac_cv_env_${ac_var}_set
+ eval ac_new_set=\$ac_env_${ac_var}_set
+ eval ac_old_val=\$ac_cv_env_${ac_var}_value
+ eval ac_new_val=\$ac_env_${ac_var}_value
+ case $ac_old_set,$ac_new_set in
+ set,)
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
+printf "%s\n" "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,set)
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5
+printf "%s\n" "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,);;
+ *)
+ if test "x$ac_old_val" != "x$ac_new_val"; then
+ # differences in whitespace do not lead to failure.
+ ac_old_val_w=`echo x $ac_old_val`
+ ac_new_val_w=`echo x $ac_new_val`
+ if test "$ac_old_val_w" != "$ac_new_val_w"; then
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5
+printf "%s\n" "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
+ ac_cache_corrupted=:
+ else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5
+printf "%s\n" "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;}
+ eval $ac_var=\$ac_old_val
fi
- { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5
-$as_echo "$as_me: former value: \`$ac_old_val'" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5
-$as_echo "$as_me: current value: \`$ac_new_val'" >&2;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5
+printf "%s\n" "$as_me: former value: \`$ac_old_val'" >&2;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5
+printf "%s\n" "$as_me: current value: \`$ac_new_val'" >&2;}
fi;;
esac
# Pass precious variables to config.status.
if test "$ac_new_set" = set; then
case $ac_new_val in
- *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
+ *\'*) ac_arg=$ac_var=`printf "%s\n" "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
*) ac_arg=$ac_var=$ac_new_val ;;
esac
case " $ac_configure_args " in
@@ -2305,11 +2866,12 @@ $as_echo "$as_me: current value: \`$ac_new_val'" >&2;}
fi
done
if $ac_cache_corrupted; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
- { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5
-$as_echo "$as_me: error: changes in the environment can compromise the build" >&2;}
- as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5
+printf "%s\n" "$as_me: error: changes in the environment can compromise the build" >&2;}
+ as_fn_error $? "run \`${MAKE-make} distclean' and/or \`rm $cache_file'
+ and start over" "$LINENO" 5
fi
## -------------------- ##
## Main body of script. ##
@@ -2326,7 +2888,14 @@ ac_compiler_gnu=$ac_cv_c_compiler_gnu
ac_config_headers="$ac_config_headers src/config.h"
+
# Checks for programs.
+
+
+
+
+
+
ac_ext=cpp
ac_cpp='$CXXCPP $CPPFLAGS'
ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5'
@@ -2337,15 +2906,16 @@ if test -z "$CXX"; then
CXX=$CCC
else
if test -n "$ac_tool_prefix"; then
- for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC
+ for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC clang++
do
# Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args.
set dummy $ac_tool_prefix$ac_prog; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_CXX+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CXX+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$CXX"; then
ac_cv_prog_CXX="$CXX" # Let the user override the test.
else
@@ -2353,11 +2923,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_CXX="$ac_tool_prefix$ac_prog"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -2368,11 +2942,11 @@ fi
fi
CXX=$ac_cv_prog_CXX
if test -n "$CXX"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CXX" >&5
-$as_echo "$CXX" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CXX" >&5
+printf "%s\n" "$CXX" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -2381,15 +2955,16 @@ fi
fi
if test -z "$CXX"; then
ac_ct_CXX=$CXX
- for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC
+ for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC clang++
do
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_ac_ct_CXX+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_ac_ct_CXX+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$ac_ct_CXX"; then
ac_cv_prog_ac_ct_CXX="$ac_ct_CXX" # Let the user override the test.
else
@@ -2397,11 +2972,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_ac_ct_CXX="$ac_prog"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -2412,11 +2991,11 @@ fi
fi
ac_ct_CXX=$ac_cv_prog_ac_ct_CXX
if test -n "$ac_ct_CXX"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CXX" >&5
-$as_echo "$ac_ct_CXX" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CXX" >&5
+printf "%s\n" "$ac_ct_CXX" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -2428,8 +3007,8 @@ done
else
case $cross_compiling:$ac_tool_warned in
yes:)
-{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
-$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
ac_tool_warned=yes ;;
esac
CXX=$ac_ct_CXX
@@ -2439,7 +3018,7 @@ fi
fi
fi
# Provide some information about the compiler.
-$as_echo "$as_me:${as_lineno-$LINENO}: checking for C++ compiler version" >&5
+printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C++ compiler version" >&5
set X $ac_compile
ac_compiler=$2
for ac_option in --version -v -V -qversion; do
@@ -2449,7 +3028,7 @@ case "(($ac_try" in
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_compiler $ac_option >&5") 2>conftest.err
ac_status=$?
if test -s conftest.err; then
@@ -2459,7 +3038,7 @@ $as_echo "$ac_try_echo"; } >&5
cat conftest.er1 >&5
fi
rm -f conftest.er1 conftest.err
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; }
done
@@ -2467,7 +3046,7 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
@@ -2479,9 +3058,9 @@ ac_clean_files="$ac_clean_files a.out a.out.dSYM a.exe b.out"
# Try to create an executable without -o first, disregard a.out.
# It will help us diagnose broken compilers, and finding out an intuition
# of exeext.
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether the C++ compiler works" >&5
-$as_echo_n "checking whether the C++ compiler works... " >&6; }
-ac_link_default=`$as_echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'`
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the C++ compiler works" >&5
+printf %s "checking whether the C++ compiler works... " >&6; }
+ac_link_default=`printf "%s\n" "$ac_link" | sed 's/ -o *conftest[^ ]*//'`
# The possible output files:
ac_files="a.out conftest.exe conftest a.exe a_out.exe b.out conftest.*"
@@ -2502,11 +3081,12 @@ case "(($ac_try" in
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_link_default") 2>&5
ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; }; then :
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ test $ac_status = 0; }
+then :
# Autoconf-2.13 could set the ac_cv_exeext variable to `no'.
# So ignore a value of `no', otherwise this would lead to `EXEEXT = no'
# in a Makefile. We should not override ac_cv_exeext if it was cached,
@@ -2523,7 +3103,7 @@ do
# certainly right.
break;;
*.* )
- if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no;
+ if test ${ac_cv_exeext+y} && test "$ac_cv_exeext" != no;
then :; else
ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'`
fi
@@ -2539,44 +3119,46 @@ do
done
test "$ac_cv_exeext" = no && ac_cv_exeext=
-else
+else $as_nop
ac_file=''
fi
-if test -z "$ac_file"; then :
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
-$as_echo "$as_me: failed program was:" >&5
+if test -z "$ac_file"
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
+printf "%s\n" "$as_me: failed program was:" >&5
sed 's/^/| /' conftest.$ac_ext >&5
-{ { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+{ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
as_fn_error 77 "C++ compiler cannot create executables
See \`config.log' for more details" "$LINENO" 5; }
-else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
-$as_echo "yes" >&6; }
-fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for C++ compiler default output file name" >&5
-$as_echo_n "checking for C++ compiler default output file name... " >&6; }
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_file" >&5
-$as_echo "$ac_file" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+printf "%s\n" "yes" >&6; }
+fi
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C++ compiler default output file name" >&5
+printf %s "checking for C++ compiler default output file name... " >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_file" >&5
+printf "%s\n" "$ac_file" >&6; }
ac_exeext=$ac_cv_exeext
rm -f -r a.out a.out.dSYM a.exe conftest$ac_cv_exeext b.out
ac_clean_files=$ac_clean_files_save
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of executables" >&5
-$as_echo_n "checking for suffix of executables... " >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for suffix of executables" >&5
+printf %s "checking for suffix of executables... " >&6; }
if { { ac_try="$ac_link"
case "(($ac_try" in
*\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_link") 2>&5
ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; }; then :
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ test $ac_status = 0; }
+then :
# If both `conftest.exe' and `conftest' are `present' (well, observable)
# catch `conftest.exe'. For instance with Cygwin, `ls conftest' will
# work properly (i.e., refer to `conftest.exe'), while it won't with
@@ -2590,15 +3172,15 @@ for ac_file in conftest.exe conftest conftest.*; do
* ) break;;
esac
done
-else
- { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+else $as_nop
+ { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
as_fn_error $? "cannot compute suffix of executables: cannot compile and link
See \`config.log' for more details" "$LINENO" 5; }
fi
rm -f conftest conftest$ac_cv_exeext
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_exeext" >&5
-$as_echo "$ac_cv_exeext" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_exeext" >&5
+printf "%s\n" "$ac_cv_exeext" >&6; }
rm -f conftest.$ac_ext
EXEEXT=$ac_cv_exeext
@@ -2607,7 +3189,7 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
#include
int
-main ()
+main (void)
{
FILE *f = fopen ("conftest.out", "w");
return ferror (f) || fclose (f) != 0;
@@ -2619,8 +3201,8 @@ _ACEOF
ac_clean_files="$ac_clean_files conftest.out"
# Check that the compiler produces executables we can run. If not, either
# the compiler is broken, or we cross compile.
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are cross compiling" >&5
-$as_echo_n "checking whether we are cross compiling... " >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether we are cross compiling" >&5
+printf %s "checking whether we are cross compiling... " >&6; }
if test "$cross_compiling" != yes; then
{ { ac_try="$ac_link"
case "(($ac_try" in
@@ -2628,10 +3210,10 @@ case "(($ac_try" in
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_link") 2>&5
ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; }
if { ac_try='./conftest$ac_cv_exeext'
{ { case "(($ac_try" in
@@ -2639,39 +3221,40 @@ $as_echo "$ac_try_echo"; } >&5
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_try") 2>&5
ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; }; }; then
cross_compiling=no
else
if test "$cross_compiling" = maybe; then
cross_compiling=yes
else
- { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
-as_fn_error $? "cannot run C++ compiled programs.
+ { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
+as_fn_error 77 "cannot run C++ compiled programs.
If you meant to cross compile, use \`--host'.
See \`config.log' for more details" "$LINENO" 5; }
fi
fi
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $cross_compiling" >&5
-$as_echo "$cross_compiling" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $cross_compiling" >&5
+printf "%s\n" "$cross_compiling" >&6; }
rm -f conftest.$ac_ext conftest$ac_cv_exeext conftest.out
ac_clean_files=$ac_clean_files_save
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of object files" >&5
-$as_echo_n "checking for suffix of object files... " >&6; }
-if ${ac_cv_objext+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for suffix of object files" >&5
+printf %s "checking for suffix of object files... " >&6; }
+if test ${ac_cv_objext+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
@@ -2685,11 +3268,12 @@ case "(($ac_try" in
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_compile") 2>&5
ac_status=$?
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
- test $ac_status = 0; }; then :
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ test $ac_status = 0; }
+then :
for ac_file in conftest.o conftest.obj conftest.*; do
test -f "$ac_file" || continue;
case $ac_file in
@@ -2698,31 +3282,32 @@ $as_echo "$ac_try_echo"; } >&5
break;;
esac
done
-else
- $as_echo "$as_me: failed program was:" >&5
+else $as_nop
+ printf "%s\n" "$as_me: failed program was:" >&5
sed 's/^/| /' conftest.$ac_ext >&5
-{ { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+{ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
as_fn_error $? "cannot compute suffix of object files: cannot compile
See \`config.log' for more details" "$LINENO" 5; }
fi
rm -f conftest.$ac_cv_objext conftest.$ac_ext
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_objext" >&5
-$as_echo "$ac_cv_objext" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_objext" >&5
+printf "%s\n" "$ac_cv_objext" >&6; }
OBJEXT=$ac_cv_objext
ac_objext=$OBJEXT
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are using the GNU C++ compiler" >&5
-$as_echo_n "checking whether we are using the GNU C++ compiler... " >&6; }
-if ${ac_cv_cxx_compiler_gnu+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the compiler supports GNU C++" >&5
+printf %s "checking whether the compiler supports GNU C++... " >&6; }
+if test ${ac_cv_cxx_compiler_gnu+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
#ifndef __GNUC__
choke me
@@ -2732,29 +3317,33 @@ main ()
return 0;
}
_ACEOF
-if ac_fn_cxx_try_compile "$LINENO"; then :
+if ac_fn_cxx_try_compile "$LINENO"
+then :
ac_compiler_gnu=yes
-else
+else $as_nop
ac_compiler_gnu=no
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
ac_cv_cxx_compiler_gnu=$ac_compiler_gnu
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_cxx_compiler_gnu" >&5
-$as_echo "$ac_cv_cxx_compiler_gnu" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_cxx_compiler_gnu" >&5
+printf "%s\n" "$ac_cv_cxx_compiler_gnu" >&6; }
+ac_compiler_gnu=$ac_cv_cxx_compiler_gnu
+
if test $ac_compiler_gnu = yes; then
GXX=yes
else
GXX=
fi
-ac_test_CXXFLAGS=${CXXFLAGS+set}
+ac_test_CXXFLAGS=${CXXFLAGS+y}
ac_save_CXXFLAGS=$CXXFLAGS
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CXX accepts -g" >&5
-$as_echo_n "checking whether $CXX accepts -g... " >&6; }
-if ${ac_cv_prog_cxx_g+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether $CXX accepts -g" >&5
+printf %s "checking whether $CXX accepts -g... " >&6; }
+if test ${ac_cv_prog_cxx_g+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_save_cxx_werror_flag=$ac_cxx_werror_flag
ac_cxx_werror_flag=yes
ac_cv_prog_cxx_g=no
@@ -2763,57 +3352,60 @@ else
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_cxx_try_compile "$LINENO"; then :
+if ac_fn_cxx_try_compile "$LINENO"
+then :
ac_cv_prog_cxx_g=yes
-else
+else $as_nop
CXXFLAGS=""
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_cxx_try_compile "$LINENO"; then :
+if ac_fn_cxx_try_compile "$LINENO"
+then :
-else
+else $as_nop
ac_cxx_werror_flag=$ac_save_cxx_werror_flag
CXXFLAGS="-g"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_cxx_try_compile "$LINENO"; then :
+if ac_fn_cxx_try_compile "$LINENO"
+then :
ac_cv_prog_cxx_g=yes
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
ac_cxx_werror_flag=$ac_save_cxx_werror_flag
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_g" >&5
-$as_echo "$ac_cv_prog_cxx_g" >&6; }
-if test "$ac_test_CXXFLAGS" = set; then
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_g" >&5
+printf "%s\n" "$ac_cv_prog_cxx_g" >&6; }
+if test $ac_test_CXXFLAGS; then
CXXFLAGS=$ac_save_CXXFLAGS
elif test $ac_cv_prog_cxx_g = yes; then
if test "$GXX" = yes; then
@@ -2828,12 +3420,115 @@ else
CXXFLAGS=
fi
fi
+ac_prog_cxx_stdcxx=no
+if test x$ac_prog_cxx_stdcxx = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CXX option to enable C++11 features" >&5
+printf %s "checking for $CXX option to enable C++11 features... " >&6; }
+if test ${ac_cv_prog_cxx_11+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_cv_prog_cxx_11=no
+ac_save_CXX=$CXX
+cat confdefs.h - <<_ACEOF >conftest.$ac_ext
+/* end confdefs.h. */
+$ac_cxx_conftest_cxx11_program
+_ACEOF
+for ac_arg in '' -std=gnu++11 -std=gnu++0x -std=c++11 -std=c++0x -qlanglvl=extended0x -AA
+do
+ CXX="$ac_save_CXX $ac_arg"
+ if ac_fn_cxx_try_compile "$LINENO"
+then :
+ ac_cv_prog_cxx_cxx11=$ac_arg
+fi
+rm -f core conftest.err conftest.$ac_objext conftest.beam
+ test "x$ac_cv_prog_cxx_cxx11" != "xno" && break
+done
+rm -f conftest.$ac_ext
+CXX=$ac_save_CXX
+fi
+
+if test "x$ac_cv_prog_cxx_cxx11" = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
+printf "%s\n" "unsupported" >&6; }
+else $as_nop
+ if test "x$ac_cv_prog_cxx_cxx11" = x
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
+printf "%s\n" "none needed" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_cxx11" >&5
+printf "%s\n" "$ac_cv_prog_cxx_cxx11" >&6; }
+ CXX="$CXX $ac_cv_prog_cxx_cxx11"
+fi
+ ac_cv_prog_cxx_stdcxx=$ac_cv_prog_cxx_cxx11
+ ac_prog_cxx_stdcxx=cxx11
+fi
+fi
+if test x$ac_prog_cxx_stdcxx = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CXX option to enable C++98 features" >&5
+printf %s "checking for $CXX option to enable C++98 features... " >&6; }
+if test ${ac_cv_prog_cxx_98+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_cv_prog_cxx_98=no
+ac_save_CXX=$CXX
+cat confdefs.h - <<_ACEOF >conftest.$ac_ext
+/* end confdefs.h. */
+$ac_cxx_conftest_cxx98_program
+_ACEOF
+for ac_arg in '' -std=gnu++98 -std=c++98 -qlanglvl=extended -AA
+do
+ CXX="$ac_save_CXX $ac_arg"
+ if ac_fn_cxx_try_compile "$LINENO"
+then :
+ ac_cv_prog_cxx_cxx98=$ac_arg
+fi
+rm -f core conftest.err conftest.$ac_objext conftest.beam
+ test "x$ac_cv_prog_cxx_cxx98" != "xno" && break
+done
+rm -f conftest.$ac_ext
+CXX=$ac_save_CXX
+fi
+
+if test "x$ac_cv_prog_cxx_cxx98" = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
+printf "%s\n" "unsupported" >&6; }
+else $as_nop
+ if test "x$ac_cv_prog_cxx_cxx98" = x
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
+printf "%s\n" "none needed" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_cxx98" >&5
+printf "%s\n" "$ac_cv_prog_cxx_cxx98" >&6; }
+ CXX="$CXX $ac_cv_prog_cxx_cxx98"
+fi
+ ac_cv_prog_cxx_stdcxx=$ac_cv_prog_cxx_cxx98
+ ac_prog_cxx_stdcxx=cxx98
+fi
+fi
+
ac_ext=c
ac_cpp='$CPP $CPPFLAGS'
ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+
+
+
+
+
+
+
ac_ext=c
ac_cpp='$CPP $CPPFLAGS'
ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
@@ -2842,11 +3537,12 @@ ac_compiler_gnu=$ac_cv_c_compiler_gnu
if test -n "$ac_tool_prefix"; then
# Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args.
set dummy ${ac_tool_prefix}gcc; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$CC"; then
ac_cv_prog_CC="$CC" # Let the user override the test.
else
@@ -2854,11 +3550,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_CC="${ac_tool_prefix}gcc"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -2869,11 +3569,11 @@ fi
fi
CC=$ac_cv_prog_CC
if test -n "$CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
-$as_echo "$CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
+printf "%s\n" "$CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -2882,11 +3582,12 @@ if test -z "$ac_cv_prog_CC"; then
ac_ct_CC=$CC
# Extract the first word of "gcc", so it can be a program name with args.
set dummy gcc; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_ac_ct_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_ac_ct_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$ac_ct_CC"; then
ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
else
@@ -2894,11 +3595,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_ac_ct_CC="gcc"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -2909,11 +3614,11 @@ fi
fi
ac_ct_CC=$ac_cv_prog_ac_ct_CC
if test -n "$ac_ct_CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5
-$as_echo "$ac_ct_CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5
+printf "%s\n" "$ac_ct_CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
if test "x$ac_ct_CC" = x; then
@@ -2921,8 +3626,8 @@ fi
else
case $cross_compiling:$ac_tool_warned in
yes:)
-{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
-$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
ac_tool_warned=yes ;;
esac
CC=$ac_ct_CC
@@ -2935,11 +3640,12 @@ if test -z "$CC"; then
if test -n "$ac_tool_prefix"; then
# Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args.
set dummy ${ac_tool_prefix}cc; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$CC"; then
ac_cv_prog_CC="$CC" # Let the user override the test.
else
@@ -2947,11 +3653,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_CC="${ac_tool_prefix}cc"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -2962,11 +3672,11 @@ fi
fi
CC=$ac_cv_prog_CC
if test -n "$CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
-$as_echo "$CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
+printf "%s\n" "$CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -2975,11 +3685,12 @@ fi
if test -z "$CC"; then
# Extract the first word of "cc", so it can be a program name with args.
set dummy cc; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$CC"; then
ac_cv_prog_CC="$CC" # Let the user override the test.
else
@@ -2988,15 +3699,19 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
- if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
+ if test "$as_dir$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then
ac_prog_rejected=yes
continue
fi
ac_cv_prog_CC="cc"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -3012,18 +3727,18 @@ if test $ac_prog_rejected = yes; then
# However, it has the same basename, so the bogon will be chosen
# first if we set CC to just the basename; use the full file name.
shift
- ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@"
+ ac_cv_prog_CC="$as_dir$ac_word${1+' '}$@"
fi
fi
fi
fi
CC=$ac_cv_prog_CC
if test -n "$CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
-$as_echo "$CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
+printf "%s\n" "$CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -3034,11 +3749,12 @@ if test -z "$CC"; then
do
# Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args.
set dummy $ac_tool_prefix$ac_prog; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$CC"; then
ac_cv_prog_CC="$CC" # Let the user override the test.
else
@@ -3046,11 +3762,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_CC="$ac_tool_prefix$ac_prog"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -3061,11 +3781,11 @@ fi
fi
CC=$ac_cv_prog_CC
if test -n "$CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
-$as_echo "$CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
+printf "%s\n" "$CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -3078,11 +3798,12 @@ if test -z "$CC"; then
do
# Extract the first word of "$ac_prog", so it can be a program name with args.
set dummy $ac_prog; ac_word=$2
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
-$as_echo_n "checking for $ac_word... " >&6; }
-if ${ac_cv_prog_ac_ct_CC+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_ac_ct_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
if test -n "$ac_ct_CC"; then
ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
else
@@ -3090,11 +3811,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
ac_cv_prog_ac_ct_CC="$ac_prog"
- $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
break 2
fi
done
@@ -3105,11 +3830,11 @@ fi
fi
ac_ct_CC=$ac_cv_prog_ac_ct_CC
if test -n "$ac_ct_CC"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5
-$as_echo "$ac_ct_CC" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5
+printf "%s\n" "$ac_ct_CC" >&6; }
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
fi
@@ -3121,34 +3846,138 @@ done
else
case $cross_compiling:$ac_tool_warned in
yes:)
-{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
-$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
ac_tool_warned=yes ;;
esac
CC=$ac_ct_CC
fi
fi
+fi
+if test -z "$CC"; then
+ if test -n "$ac_tool_prefix"; then
+ # Extract the first word of "${ac_tool_prefix}clang", so it can be a program name with args.
+set dummy ${ac_tool_prefix}clang; ac_word=$2
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ if test -n "$CC"; then
+ ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
+ ac_cv_prog_CC="${ac_tool_prefix}clang"
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+ done
+IFS=$as_save_IFS
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5
+printf "%s\n" "$CC" >&6; }
+else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
+fi
+
+
+fi
+if test -z "$ac_cv_prog_CC"; then
+ ac_ct_CC=$CC
+ # Extract the first word of "clang", so it can be a program name with args.
+set dummy clang; ac_word=$2
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5
+printf %s "checking for $ac_word... " >&6; }
+if test ${ac_cv_prog_ac_ct_CC+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ if test -n "$ac_ct_CC"; then
+ ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then
+ ac_cv_prog_ac_ct_CC="clang"
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+ done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5
+printf "%s\n" "$ac_ct_CC" >&6; }
+else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
+fi
+
+ if test "x$ac_ct_CC" = x; then
+ CC=""
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5
+printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;}
+ac_tool_warned=yes ;;
+esac
+ CC=$ac_ct_CC
+ fi
+else
+ CC="$ac_cv_prog_CC"
+fi
+
fi
-test -z "$CC" && { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
+test -z "$CC" && { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
+printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;}
as_fn_error $? "no acceptable C compiler found in \$PATH
See \`config.log' for more details" "$LINENO" 5; }
# Provide some information about the compiler.
-$as_echo "$as_me:${as_lineno-$LINENO}: checking for C compiler version" >&5
+printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C compiler version" >&5
set X $ac_compile
ac_compiler=$2
-for ac_option in --version -v -V -qversion; do
+for ac_option in --version -v -V -qversion -version; do
{ { ac_try="$ac_compiler $ac_option >&5"
case "(($ac_try" in
*\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
*) ac_try_echo=$ac_try;;
esac
eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\""
-$as_echo "$ac_try_echo"; } >&5
+printf "%s\n" "$ac_try_echo"; } >&5
(eval "$ac_compiler $ac_option >&5") 2>conftest.err
ac_status=$?
if test -s conftest.err; then
@@ -3158,20 +3987,21 @@ $as_echo "$ac_try_echo"; } >&5
cat conftest.er1 >&5
fi
rm -f conftest.er1 conftest.err
- $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5
test $ac_status = 0; }
done
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are using the GNU C compiler" >&5
-$as_echo_n "checking whether we are using the GNU C compiler... " >&6; }
-if ${ac_cv_c_compiler_gnu+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the compiler supports GNU C" >&5
+printf %s "checking whether the compiler supports GNU C... " >&6; }
+if test ${ac_cv_c_compiler_gnu+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
#ifndef __GNUC__
choke me
@@ -3181,29 +4011,33 @@ main ()
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
ac_compiler_gnu=yes
-else
+else $as_nop
ac_compiler_gnu=no
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
ac_cv_c_compiler_gnu=$ac_compiler_gnu
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_compiler_gnu" >&5
-$as_echo "$ac_cv_c_compiler_gnu" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_compiler_gnu" >&5
+printf "%s\n" "$ac_cv_c_compiler_gnu" >&6; }
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
if test $ac_compiler_gnu = yes; then
GCC=yes
else
GCC=
fi
-ac_test_CFLAGS=${CFLAGS+set}
+ac_test_CFLAGS=${CFLAGS+y}
ac_save_CFLAGS=$CFLAGS
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CC accepts -g" >&5
-$as_echo_n "checking whether $CC accepts -g... " >&6; }
-if ${ac_cv_prog_cc_g+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether $CC accepts -g" >&5
+printf %s "checking whether $CC accepts -g... " >&6; }
+if test ${ac_cv_prog_cc_g+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_save_c_werror_flag=$ac_c_werror_flag
ac_c_werror_flag=yes
ac_cv_prog_cc_g=no
@@ -3212,57 +4046,60 @@ else
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
ac_cv_prog_cc_g=yes
-else
+else $as_nop
CFLAGS=""
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
-else
+else $as_nop
ac_c_werror_flag=$ac_save_c_werror_flag
CFLAGS="-g"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
int
-main ()
+main (void)
{
;
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
ac_cv_prog_cc_g=yes
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
ac_c_werror_flag=$ac_save_c_werror_flag
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_g" >&5
-$as_echo "$ac_cv_prog_cc_g" >&6; }
-if test "$ac_test_CFLAGS" = set; then
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_g" >&5
+printf "%s\n" "$ac_cv_prog_cc_g" >&6; }
+if test $ac_test_CFLAGS; then
CFLAGS=$ac_save_CFLAGS
elif test $ac_cv_prog_cc_g = yes; then
if test "$GCC" = yes; then
@@ -3277,94 +4114,144 @@ else
CFLAGS=
fi
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $CC option to accept ISO C89" >&5
-$as_echo_n "checking for $CC option to accept ISO C89... " >&6; }
-if ${ac_cv_prog_cc_c89+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- ac_cv_prog_cc_c89=no
+ac_prog_cc_stdc=no
+if test x$ac_prog_cc_stdc = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C11 features" >&5
+printf %s "checking for $CC option to enable C11 features... " >&6; }
+if test ${ac_cv_prog_cc_c11+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_cv_prog_cc_c11=no
ac_save_CC=$CC
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
-#include
-#include
-struct stat;
-/* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */
-struct buf { int x; };
-FILE * (*rcsopen) (struct buf *, struct stat *, int);
-static char *e (p, i)
- char **p;
- int i;
-{
- return p[i];
-}
-static char *f (char * (*g) (char **, int), char **p, ...)
-{
- char *s;
- va_list v;
- va_start (v,p);
- s = g (p, va_arg (v,int));
- va_end (v);
- return s;
-}
-
-/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has
- function prototypes and stuff, but not '\xHH' hex character constants.
- These don't provoke an error unfortunately, instead are silently treated
- as 'x'. The following induces an error, until -std is added to get
- proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an
- array size at least. It's necessary to write '\x00'==0 to get something
- that's true only with -std. */
-int osf4_cc_array ['\x00' == 0 ? 1 : -1];
+$ac_c_conftest_c11_program
+_ACEOF
+for ac_arg in '' -std=gnu11
+do
+ CC="$ac_save_CC $ac_arg"
+ if ac_fn_c_try_compile "$LINENO"
+then :
+ ac_cv_prog_cc_c11=$ac_arg
+fi
+rm -f core conftest.err conftest.$ac_objext conftest.beam
+ test "x$ac_cv_prog_cc_c11" != "xno" && break
+done
+rm -f conftest.$ac_ext
+CC=$ac_save_CC
+fi
-/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters
- inside strings and character constants. */
-#define FOO(x) 'x'
-int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1];
+if test "x$ac_cv_prog_cc_c11" = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
+printf "%s\n" "unsupported" >&6; }
+else $as_nop
+ if test "x$ac_cv_prog_cc_c11" = x
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
+printf "%s\n" "none needed" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c11" >&5
+printf "%s\n" "$ac_cv_prog_cc_c11" >&6; }
+ CC="$CC $ac_cv_prog_cc_c11"
+fi
+ ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c11
+ ac_prog_cc_stdc=c11
+fi
+fi
+if test x$ac_prog_cc_stdc = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C99 features" >&5
+printf %s "checking for $CC option to enable C99 features... " >&6; }
+if test ${ac_cv_prog_cc_c99+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_cv_prog_cc_c99=no
+ac_save_CC=$CC
+cat confdefs.h - <<_ACEOF >conftest.$ac_ext
+/* end confdefs.h. */
+$ac_c_conftest_c99_program
+_ACEOF
+for ac_arg in '' -std=gnu99 -std=c99 -c99 -qlanglvl=extc1x -qlanglvl=extc99 -AC99 -D_STDC_C99=
+do
+ CC="$ac_save_CC $ac_arg"
+ if ac_fn_c_try_compile "$LINENO"
+then :
+ ac_cv_prog_cc_c99=$ac_arg
+fi
+rm -f core conftest.err conftest.$ac_objext conftest.beam
+ test "x$ac_cv_prog_cc_c99" != "xno" && break
+done
+rm -f conftest.$ac_ext
+CC=$ac_save_CC
+fi
-int test (int i, double x);
-struct s1 {int (*f) (int a);};
-struct s2 {int (*f) (double a);};
-int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int);
-int argc;
-char **argv;
-int
-main ()
-{
-return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1];
- ;
- return 0;
-}
+if test "x$ac_cv_prog_cc_c99" = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
+printf "%s\n" "unsupported" >&6; }
+else $as_nop
+ if test "x$ac_cv_prog_cc_c99" = x
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
+printf "%s\n" "none needed" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c99" >&5
+printf "%s\n" "$ac_cv_prog_cc_c99" >&6; }
+ CC="$CC $ac_cv_prog_cc_c99"
+fi
+ ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c99
+ ac_prog_cc_stdc=c99
+fi
+fi
+if test x$ac_prog_cc_stdc = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C89 features" >&5
+printf %s "checking for $CC option to enable C89 features... " >&6; }
+if test ${ac_cv_prog_cc_c89+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_cv_prog_cc_c89=no
+ac_save_CC=$CC
+cat confdefs.h - <<_ACEOF >conftest.$ac_ext
+/* end confdefs.h. */
+$ac_c_conftest_c89_program
_ACEOF
-for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \
- -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__"
+for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__"
do
CC="$ac_save_CC $ac_arg"
- if ac_fn_c_try_compile "$LINENO"; then :
+ if ac_fn_c_try_compile "$LINENO"
+then :
ac_cv_prog_cc_c89=$ac_arg
fi
-rm -f core conftest.err conftest.$ac_objext
+rm -f core conftest.err conftest.$ac_objext conftest.beam
test "x$ac_cv_prog_cc_c89" != "xno" && break
done
rm -f conftest.$ac_ext
CC=$ac_save_CC
-
fi
-# AC_CACHE_VAL
-case "x$ac_cv_prog_cc_c89" in
- x)
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
-$as_echo "none needed" >&6; } ;;
- xno)
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
-$as_echo "unsupported" >&6; } ;;
- *)
- CC="$CC $ac_cv_prog_cc_c89"
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c89" >&5
-$as_echo "$ac_cv_prog_cc_c89" >&6; } ;;
-esac
-if test "x$ac_cv_prog_cc_c89" != xno; then :
+if test "x$ac_cv_prog_cc_c89" = xno
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5
+printf "%s\n" "unsupported" >&6; }
+else $as_nop
+ if test "x$ac_cv_prog_cc_c89" = x
+then :
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5
+printf "%s\n" "none needed" >&6; }
+else $as_nop
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c89" >&5
+printf "%s\n" "$ac_cv_prog_cc_c89" >&6; }
+ CC="$CC $ac_cv_prog_cc_c89"
+fi
+ ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c89
+ ac_prog_cc_stdc=c89
+fi
fi
ac_ext=c
@@ -3373,36 +4260,9 @@ ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
ac_compiler_gnu=$ac_cv_c_compiler_gnu
-ac_aux_dir=
-for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do
- if test -f "$ac_dir/install-sh"; then
- ac_aux_dir=$ac_dir
- ac_install_sh="$ac_aux_dir/install-sh -c"
- break
- elif test -f "$ac_dir/install.sh"; then
- ac_aux_dir=$ac_dir
- ac_install_sh="$ac_aux_dir/install.sh -c"
- break
- elif test -f "$ac_dir/shtool"; then
- ac_aux_dir=$ac_dir
- ac_install_sh="$ac_aux_dir/shtool install -c"
- break
- fi
-done
-if test -z "$ac_aux_dir"; then
- as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5
-fi
-
-# These three variables are undocumented and unsupported,
-# and are intended to be withdrawn in a future Autoconf release.
-# They can cause serious problems if a builder's source tree is in a directory
-# whose full name contains unusual characters.
-ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var.
-ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var.
-ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var.
-# Find a good install program. We prefer a C program (faster),
+ # Find a good install program. We prefer a C program (faster),
# so one script is as good as another. But avoid the broken or
# incompatible versions:
# SysV /etc/install, /usr/sbin/install
@@ -3416,20 +4276,25 @@ ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var.
# OS/2's system install, which has a completely different semantic
# ./install, which can be erroneously created by make from ./install.sh.
# Reject install programs that cannot install multiple files.
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5
-$as_echo_n "checking for a BSD-compatible install... " >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5
+printf %s "checking for a BSD-compatible install... " >&6; }
if test -z "$INSTALL"; then
-if ${ac_cv_path_install+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+if test ${ac_cv_path_install+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- # Account for people who put trailing slashes in PATH elements.
-case $as_dir/ in #((
- ./ | .// | /[cC]/* | \
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ # Account for fact that we put trailing slashes in our PATH walk.
+case $as_dir in #((
+ ./ | /[cC]/* | \
/etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \
?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \
/usr/ucb/* ) ;;
@@ -3439,13 +4304,13 @@ case $as_dir/ in #((
# by default.
for ac_prog in ginstall scoinst install; do
for ac_exec_ext in '' $ac_executable_extensions; do
- if as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then
+ if as_fn_executable_p "$as_dir$ac_prog$ac_exec_ext"; then
if test $ac_prog = install &&
- grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ grep dspmsg "$as_dir$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
# AIX install. It has an incompatible calling convention.
:
elif test $ac_prog = install &&
- grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ grep pwplus "$as_dir$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
# program-specific install script used by HP pwplus--don't use.
:
else
@@ -3453,12 +4318,12 @@ case $as_dir/ in #((
echo one > conftest.one
echo two > conftest.two
mkdir conftest.dir
- if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" &&
+ if "$as_dir$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir/" &&
test -s conftest.one && test -s conftest.two &&
test -s conftest.dir/conftest.one &&
test -s conftest.dir/conftest.two
then
- ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c"
+ ac_cv_path_install="$as_dir$ac_prog$ac_exec_ext -c"
break 3
fi
fi
@@ -3474,7 +4339,7 @@ IFS=$as_save_IFS
rm -rf conftest.one conftest.two conftest.dir
fi
- if test "${ac_cv_path_install+set}" = set; then
+ if test ${ac_cv_path_install+y}; then
INSTALL=$ac_cv_path_install
else
# As a last resort, use the slow shell script. Don't cache a
@@ -3484,8 +4349,8 @@ fi
INSTALL=$ac_install_sh
fi
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5
-$as_echo "$INSTALL" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5
+printf "%s\n" "$INSTALL" >&6; }
# Use test -z because SunOS4 sh mishandles braces in ${var-val}.
# It thinks the first close brace ends the variable substitution.
@@ -3495,13 +4360,14 @@ test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}'
test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644'
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5
-$as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5
+printf %s "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; }
set x ${MAKE-make}
-ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'`
-if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ac_make=`printf "%s\n" "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'`
+if eval test \${ac_cv_prog_make_${ac_make}_set+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat >conftest.make <<\_ACEOF
SHELL = /bin/sh
all:
@@ -3517,12 +4383,12 @@ esac
rm -f conftest.make
fi
if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5
-$as_echo "yes" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: yes" >&5
+printf "%s\n" "yes" >&6; }
SET_MAKE=
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5
-$as_echo "no" >&6; }
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5
+printf "%s\n" "no" >&6; }
SET_MAKE="MAKE=${MAKE-make}"
fi
@@ -3538,11 +4404,12 @@ esac
# Checks for libraries.
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for sha256_Raw in -lbc-crypto-base" >&5
-$as_echo_n "checking for sha256_Raw in -lbc-crypto-base... " >&6; }
-if ${ac_cv_lib_bc_crypto_base_sha256_Raw+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for sha256_Raw in -lbc-crypto-base" >&5
+printf %s "checking for sha256_Raw in -lbc-crypto-base... " >&6; }
+if test ${ac_cv_lib_bc_crypto_base_sha256_Raw+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-lbc-crypto-base $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3551,48 +4418,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char sha256_Raw ();
int
-main ()
+main (void)
{
return sha256_Raw ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_bc_crypto_base_sha256_Raw=yes
-else
+else $as_nop
ac_cv_lib_bc_crypto_base_sha256_Raw=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_crypto_base_sha256_Raw" >&5
-$as_echo "$ac_cv_lib_bc_crypto_base_sha256_Raw" >&6; }
-if test "x$ac_cv_lib_bc_crypto_base_sha256_Raw" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBBC_CRYPTO_BASE 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_crypto_base_sha256_Raw" >&5
+printf "%s\n" "$ac_cv_lib_bc_crypto_base_sha256_Raw" >&6; }
+if test "x$ac_cv_lib_bc_crypto_base_sha256_Raw" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBBC_CRYPTO_BASE 1" >>confdefs.h
LIBS="-lbc-crypto-base $LIBS"
-else
+else $as_nop
echo "### Error! libbc-crypto-base must be installed first."
exit -1
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for split_secret in -lbc-shamir" >&5
-$as_echo_n "checking for split_secret in -lbc-shamir... " >&6; }
-if ${ac_cv_lib_bc_shamir_split_secret+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for split_secret in -lbc-shamir" >&5
+printf %s "checking for split_secret in -lbc-shamir... " >&6; }
+if test ${ac_cv_lib_bc_shamir_split_secret+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-lbc-shamir $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3601,48 +4466,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char split_secret ();
int
-main ()
+main (void)
{
return split_secret ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_bc_shamir_split_secret=yes
-else
+else $as_nop
ac_cv_lib_bc_shamir_split_secret=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_shamir_split_secret" >&5
-$as_echo "$ac_cv_lib_bc_shamir_split_secret" >&6; }
-if test "x$ac_cv_lib_bc_shamir_split_secret" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBBC_SHAMIR 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_shamir_split_secret" >&5
+printf "%s\n" "$ac_cv_lib_bc_shamir_split_secret" >&6; }
+if test "x$ac_cv_lib_bc_shamir_split_secret" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBBC_SHAMIR 1" >>confdefs.h
LIBS="-lbc-shamir $LIBS"
-else
+else $as_nop
echo "### Error! libbc-shamir must be installed first."
exit -1
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for sskr_generate in -lbc-sskr" >&5
-$as_echo_n "checking for sskr_generate in -lbc-sskr... " >&6; }
-if ${ac_cv_lib_bc_sskr_sskr_generate+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for sskr_generate in -lbc-sskr" >&5
+printf %s "checking for sskr_generate in -lbc-sskr... " >&6; }
+if test ${ac_cv_lib_bc_sskr_sskr_generate+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-lbc-sskr $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3651,48 +4514,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char sskr_generate ();
int
-main ()
+main (void)
{
return sskr_generate ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_bc_sskr_sskr_generate=yes
-else
+else $as_nop
ac_cv_lib_bc_sskr_sskr_generate=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_sskr_sskr_generate" >&5
-$as_echo "$ac_cv_lib_bc_sskr_sskr_generate" >&6; }
-if test "x$ac_cv_lib_bc_sskr_sskr_generate" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBBC_SSKR 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_sskr_sskr_generate" >&5
+printf "%s\n" "$ac_cv_lib_bc_sskr_sskr_generate" >&6; }
+if test "x$ac_cv_lib_bc_sskr_sskr_generate" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBBC_SSKR 1" >>confdefs.h
LIBS="-lbc-sskr $LIBS"
-else
+else $as_nop
echo "### Error! libbc-sskr must be installed first."
exit -1
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for bip39_mnemonic_from_word in -lbc-bip39" >&5
-$as_echo_n "checking for bip39_mnemonic_from_word in -lbc-bip39... " >&6; }
-if ${ac_cv_lib_bc_bip39_bip39_mnemonic_from_word+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for bip39_mnemonic_from_word in -lbc-bip39" >&5
+printf %s "checking for bip39_mnemonic_from_word in -lbc-bip39... " >&6; }
+if test ${ac_cv_lib_bc_bip39_bip39_mnemonic_from_word+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-lbc-bip39 $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3701,48 +4562,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char bip39_mnemonic_from_word ();
int
-main ()
+main (void)
{
return bip39_mnemonic_from_word ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_bc_bip39_bip39_mnemonic_from_word=yes
-else
+else $as_nop
ac_cv_lib_bc_bip39_bip39_mnemonic_from_word=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&5
-$as_echo "$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&6; }
-if test "x$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBBC_BIP39 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&5
+printf "%s\n" "$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&6; }
+if test "x$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBBC_BIP39 1" >>confdefs.h
LIBS="-lbc-bip39 $LIBS"
-else
+else $as_nop
echo "### Error! libbc-bip39 must be installed first."
exit -1
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for ur_crc32n in -lbc-ur" >&5
-$as_echo_n "checking for ur_crc32n in -lbc-ur... " >&6; }
-if ${ac_cv_lib_bc_ur_ur_crc32n+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for ur_crc32n in -lbc-ur" >&5
+printf %s "checking for ur_crc32n in -lbc-ur... " >&6; }
+if test ${ac_cv_lib_bc_ur_ur_crc32n+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-lbc-ur $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3751,48 +4610,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char ur_crc32n ();
int
-main ()
+main (void)
{
return ur_crc32n ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_bc_ur_ur_crc32n=yes
-else
+else $as_nop
ac_cv_lib_bc_ur_ur_crc32n=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_ur_ur_crc32n" >&5
-$as_echo "$ac_cv_lib_bc_ur_ur_crc32n" >&6; }
-if test "x$ac_cv_lib_bc_ur_ur_crc32n" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBBC_UR 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_ur_ur_crc32n" >&5
+printf "%s\n" "$ac_cv_lib_bc_ur_ur_crc32n" >&6; }
+if test "x$ac_cv_lib_bc_ur_ur_crc32n" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBBC_UR 1" >>confdefs.h
LIBS="-lbc-ur $LIBS"
-else
+else $as_nop
echo "### Error! libbc-ur must be installed first."
exit -1
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for argp_parse in -largp" >&5
-$as_echo_n "checking for argp_parse in -largp... " >&6; }
-if ${ac_cv_lib_argp_argp_parse+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for argp_parse in -largp" >&5
+printf %s "checking for argp_parse in -largp... " >&6; }
+if test ${ac_cv_lib_argp_argp_parse+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_check_lib_save_LIBS=$LIBS
LIBS="-largp $LIBS"
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
@@ -3801,37 +4658,34 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* Override any GCC internal prototype to avoid an error.
Use char because int might match the return type of a GCC
builtin and then its argument prototype would still apply. */
-#ifdef __cplusplus
-extern "C"
-#endif
char argp_parse ();
int
-main ()
+main (void)
{
return argp_parse ();
;
return 0;
}
_ACEOF
-if ac_fn_c_try_link "$LINENO"; then :
+if ac_fn_c_try_link "$LINENO"
+then :
ac_cv_lib_argp_argp_parse=yes
-else
+else $as_nop
ac_cv_lib_argp_argp_parse=no
fi
-rm -f core conftest.err conftest.$ac_objext \
+rm -f core conftest.err conftest.$ac_objext conftest.beam \
conftest$ac_exeext conftest.$ac_ext
LIBS=$ac_check_lib_save_LIBS
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_argp_argp_parse" >&5
-$as_echo "$ac_cv_lib_argp_argp_parse" >&6; }
-if test "x$ac_cv_lib_argp_argp_parse" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_LIBARGP 1
-_ACEOF
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_argp_argp_parse" >&5
+printf "%s\n" "$ac_cv_lib_argp_argp_parse" >&6; }
+if test "x$ac_cv_lib_argp_argp_parse" = xyes
+then :
+ printf "%s\n" "#define HAVE_LIBARGP 1" >>confdefs.h
LIBS="-largp $LIBS"
-else
+else $as_nop
echo "### Error! argp must be installed first. Try 'brew install argp-standalone'."
exit -1
@@ -3840,531 +4694,262 @@ fi
# Checks for header files.
-ac_ext=c
-ac_cpp='$CPP $CPPFLAGS'
-ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
-ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
-ac_compiler_gnu=$ac_cv_c_compiler_gnu
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking how to run the C preprocessor" >&5
-$as_echo_n "checking how to run the C preprocessor... " >&6; }
-# On Suns, sometimes $CPP names a directory.
-if test -n "$CPP" && test -d "$CPP"; then
- CPP=
-fi
-if test -z "$CPP"; then
- if ${ac_cv_prog_CPP+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- # Double quotes because CPP needs to be expanded
- for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp"
- do
- ac_preproc_ok=false
-for ac_c_preproc_warn_flag in '' yes
+ac_header= ac_cache=
+for ac_item in $ac_header_c_list
do
- # Use a header file that comes with gcc, so configuring glibc
- # with a fresh cross-compiler works.
- # Prefer to if __STDC__ is defined, since
- # exists even on freestanding compilers.
- # On the NeXT, cc -E runs the code through the compiler's parser,
- # not just through cpp. "Syntax error" is here to catch this case.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#ifdef __STDC__
-# include
-#else
-# include
-#endif
- Syntax error
-_ACEOF
-if ac_fn_c_try_cpp "$LINENO"; then :
-
-else
- # Broken: fails on valid input.
-continue
-fi
-rm -f conftest.err conftest.i conftest.$ac_ext
-
- # OK, works on sane cases. Now check whether nonexistent headers
- # can be detected and how.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-_ACEOF
-if ac_fn_c_try_cpp "$LINENO"; then :
- # Broken: success on invalid input.
-continue
-else
- # Passes both tests.
-ac_preproc_ok=:
-break
-fi
-rm -f conftest.err conftest.i conftest.$ac_ext
-
+ if test $ac_cache; then
+ ac_fn_c_check_header_compile "$LINENO" $ac_header ac_cv_header_$ac_cache "$ac_includes_default"
+ if eval test \"x\$ac_cv_header_$ac_cache\" = xyes; then
+ printf "%s\n" "#define $ac_item 1" >> confdefs.h
+ fi
+ ac_header= ac_cache=
+ elif test $ac_header; then
+ ac_cache=$ac_item
+ else
+ ac_header=$ac_item
+ fi
done
-# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
-rm -f conftest.i conftest.err conftest.$ac_ext
-if $ac_preproc_ok; then :
- break
-fi
-
- done
- ac_cv_prog_CPP=$CPP
-fi
- CPP=$ac_cv_prog_CPP
-else
- ac_cv_prog_CPP=$CPP
-fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $CPP" >&5
-$as_echo "$CPP" >&6; }
-ac_preproc_ok=false
-for ac_c_preproc_warn_flag in '' yes
-do
- # Use a header file that comes with gcc, so configuring glibc
- # with a fresh cross-compiler works.
- # Prefer to if __STDC__ is defined, since
- # exists even on freestanding compilers.
- # On the NeXT, cc -E runs the code through the compiler's parser,
- # not just through cpp. "Syntax error" is here to catch this case.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#ifdef __STDC__
-# include
-#else
-# include
-#endif
- Syntax error
-_ACEOF
-if ac_fn_c_try_cpp "$LINENO"; then :
-else
- # Broken: fails on valid input.
-continue
-fi
-rm -f conftest.err conftest.i conftest.$ac_ext
- # OK, works on sane cases. Now check whether nonexistent headers
- # can be detected and how.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-_ACEOF
-if ac_fn_c_try_cpp "$LINENO"; then :
- # Broken: success on invalid input.
-continue
-else
- # Passes both tests.
-ac_preproc_ok=:
-break
-fi
-rm -f conftest.err conftest.i conftest.$ac_ext
-done
-# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
-rm -f conftest.i conftest.err conftest.$ac_ext
-if $ac_preproc_ok; then :
-else
- { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5
-$as_echo "$as_me: error: in \`$ac_pwd':" >&2;}
-as_fn_error $? "C preprocessor \"$CPP\" fails sanity check
-See \`config.log' for more details" "$LINENO" 5; }
-fi
-ac_ext=c
-ac_cpp='$CPP $CPPFLAGS'
-ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
-ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
-ac_compiler_gnu=$ac_cv_c_compiler_gnu
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for grep that handles long lines and -e" >&5
-$as_echo_n "checking for grep that handles long lines and -e... " >&6; }
-if ${ac_cv_path_GREP+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- if test -z "$GREP"; then
- ac_path_GREP_found=false
- # Loop through the user's path and test for each of PROGNAME-LIST
- as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
-for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin
-do
- IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- for ac_prog in grep ggrep; do
- for ac_exec_ext in '' $ac_executable_extensions; do
- ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext"
- as_fn_executable_p "$ac_path_GREP" || continue
-# Check for GNU ac_path_GREP and select it if it is found.
- # Check for GNU $ac_path_GREP
-case `"$ac_path_GREP" --version 2>&1` in
-*GNU*)
- ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;;
-*)
- ac_count=0
- $as_echo_n 0123456789 >"conftest.in"
- while :
- do
- cat "conftest.in" "conftest.in" >"conftest.tmp"
- mv "conftest.tmp" "conftest.in"
- cp "conftest.in" "conftest.nl"
- $as_echo 'GREP' >> "conftest.nl"
- "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break
- diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break
- as_fn_arith $ac_count + 1 && ac_count=$as_val
- if test $ac_count -gt ${ac_path_GREP_max-0}; then
- # Best one so far, save it but keep looking for a better one
- ac_cv_path_GREP="$ac_path_GREP"
- ac_path_GREP_max=$ac_count
- fi
- # 10*(2^10) chars as input seems more than enough
- test $ac_count -gt 10 && break
- done
- rm -f conftest.in conftest.tmp conftest.nl conftest.out;;
-esac
+if test $ac_cv_header_stdlib_h = yes && test $ac_cv_header_string_h = yes
+then :
- $ac_path_GREP_found && break 3
- done
- done
- done
-IFS=$as_save_IFS
- if test -z "$ac_cv_path_GREP"; then
- as_fn_error $? "no acceptable grep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5
- fi
-else
- ac_cv_path_GREP=$GREP
-fi
+printf "%s\n" "#define STDC_HEADERS 1" >>confdefs.h
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_GREP" >&5
-$as_echo "$ac_cv_path_GREP" >&6; }
- GREP="$ac_cv_path_GREP"
-
-
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for egrep" >&5
-$as_echo_n "checking for egrep... " >&6; }
-if ${ac_cv_path_EGREP+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- if echo a | $GREP -E '(a|b)' >/dev/null 2>&1
- then ac_cv_path_EGREP="$GREP -E"
- else
- if test -z "$EGREP"; then
- ac_path_EGREP_found=false
- # Loop through the user's path and test for each of PROGNAME-LIST
- as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
-for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin
-do
- IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- for ac_prog in egrep; do
- for ac_exec_ext in '' $ac_executable_extensions; do
- ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext"
- as_fn_executable_p "$ac_path_EGREP" || continue
-# Check for GNU ac_path_EGREP and select it if it is found.
- # Check for GNU $ac_path_EGREP
-case `"$ac_path_EGREP" --version 2>&1` in
-*GNU*)
- ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;;
-*)
- ac_count=0
- $as_echo_n 0123456789 >"conftest.in"
- while :
- do
- cat "conftest.in" "conftest.in" >"conftest.tmp"
- mv "conftest.tmp" "conftest.in"
- cp "conftest.in" "conftest.nl"
- $as_echo 'EGREP' >> "conftest.nl"
- "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break
- diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break
- as_fn_arith $ac_count + 1 && ac_count=$as_val
- if test $ac_count -gt ${ac_path_EGREP_max-0}; then
- # Best one so far, save it but keep looking for a better one
- ac_cv_path_EGREP="$ac_path_EGREP"
- ac_path_EGREP_max=$ac_count
- fi
- # 10*(2^10) chars as input seems more than enough
- test $ac_count -gt 10 && break
- done
- rm -f conftest.in conftest.tmp conftest.nl conftest.out;;
-esac
+ac_fn_c_check_header_compile "$LINENO" "fcntl.h" "ac_cv_header_fcntl_h" "$ac_includes_default"
+if test "x$ac_cv_header_fcntl_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_FCNTL_H 1" >>confdefs.h
- $ac_path_EGREP_found && break 3
- done
- done
- done
-IFS=$as_save_IFS
- if test -z "$ac_cv_path_EGREP"; then
- as_fn_error $? "no acceptable egrep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5
- fi
-else
- ac_cv_path_EGREP=$EGREP
fi
+ac_fn_c_check_header_compile "$LINENO" "memory.h" "ac_cv_header_memory_h" "$ac_includes_default"
+if test "x$ac_cv_header_memory_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_MEMORY_H 1" >>confdefs.h
- fi
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_EGREP" >&5
-$as_echo "$ac_cv_path_EGREP" >&6; }
- EGREP="$ac_cv_path_EGREP"
+ac_fn_c_check_header_compile "$LINENO" "stdint.h" "ac_cv_header_stdint_h" "$ac_includes_default"
+if test "x$ac_cv_header_stdint_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_STDINT_H 1" >>confdefs.h
-
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for ANSI C header files" >&5
-$as_echo_n "checking for ANSI C header files... " >&6; }
-if ${ac_cv_header_stdc+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-#include
-#include
-#include
-
-int
-main ()
-{
-
- ;
- return 0;
-}
-_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
- ac_cv_header_stdc=yes
-else
- ac_cv_header_stdc=no
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
-
-if test $ac_cv_header_stdc = yes; then
- # SunOS 4.x string.h does not declare mem*, contrary to ANSI.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-
-_ACEOF
-if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
- $EGREP "memchr" >/dev/null 2>&1; then :
+ac_fn_c_check_header_compile "$LINENO" "stdlib.h" "ac_cv_header_stdlib_h" "$ac_includes_default"
+if test "x$ac_cv_header_stdlib_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_STDLIB_H 1" >>confdefs.h
-else
- ac_cv_header_stdc=no
fi
-rm -f conftest*
+ac_fn_c_check_header_compile "$LINENO" "string.h" "ac_cv_header_string_h" "$ac_includes_default"
+if test "x$ac_cv_header_string_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_STRING_H 1" >>confdefs.h
fi
+ac_fn_c_check_header_compile "$LINENO" "strings.h" "ac_cv_header_strings_h" "$ac_includes_default"
+if test "x$ac_cv_header_strings_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_STRINGS_H 1" >>confdefs.h
-if test $ac_cv_header_stdc = yes; then
- # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI.
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-
-_ACEOF
-if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
- $EGREP "free" >/dev/null 2>&1; then :
-
-else
- ac_cv_header_stdc=no
fi
-rm -f conftest*
+ac_fn_c_check_header_compile "$LINENO" "sys/ioctl.h" "ac_cv_header_sys_ioctl_h" "$ac_includes_default"
+if test "x$ac_cv_header_sys_ioctl_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_SYS_IOCTL_H 1" >>confdefs.h
fi
+ac_fn_c_check_header_compile "$LINENO" "sys/param.h" "ac_cv_header_sys_param_h" "$ac_includes_default"
+if test "x$ac_cv_header_sys_param_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_SYS_PARAM_H 1" >>confdefs.h
-if test $ac_cv_header_stdc = yes; then
- # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi.
- if test "$cross_compiling" = yes; then :
- :
-else
- cat confdefs.h - <<_ACEOF >conftest.$ac_ext
-/* end confdefs.h. */
-#include
-#include
-#if ((' ' & 0x0FF) == 0x020)
-# define ISLOWER(c) ('a' <= (c) && (c) <= 'z')
-# define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c))
-#else
-# define ISLOWER(c) \
- (('a' <= (c) && (c) <= 'i') \
- || ('j' <= (c) && (c) <= 'r') \
- || ('s' <= (c) && (c) <= 'z'))
-# define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c))
-#endif
-
-#define XOR(e, f) (((e) && !(f)) || (!(e) && (f)))
-int
-main ()
-{
- int i;
- for (i = 0; i < 256; i++)
- if (XOR (islower (i), ISLOWER (i))
- || toupper (i) != TOUPPER (i))
- return 2;
- return 0;
-}
-_ACEOF
-if ac_fn_c_try_run "$LINENO"; then :
-
-else
- ac_cv_header_stdc=no
-fi
-rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \
- conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
+ac_fn_c_check_header_compile "$LINENO" "unistd.h" "ac_cv_header_unistd_h" "$ac_includes_default"
+if test "x$ac_cv_header_unistd_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_UNISTD_H 1" >>confdefs.h
fi
-fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdc" >&5
-$as_echo "$ac_cv_header_stdc" >&6; }
-if test $ac_cv_header_stdc = yes; then
-
-$as_echo "#define STDC_HEADERS 1" >>confdefs.h
+ac_fn_c_check_header_compile "$LINENO" "stddef.h" "ac_cv_header_stddef_h" "$ac_includes_default"
+if test "x$ac_cv_header_stddef_h" = xyes
+then :
+ printf "%s\n" "#define HAVE_STDDEF_H 1" >>confdefs.h
fi
-# On IRIX 5.3, sys/types and inttypes.h are conflicting.
-for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \
- inttypes.h stdint.h unistd.h
-do :
- as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh`
-ac_fn_c_check_header_compile "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default
-"
-if eval test \"x\$"$as_ac_Header"\" = x"yes"; then :
- cat >>confdefs.h <<_ACEOF
-#define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1
-_ACEOF
-
-fi
-done
+# Checks for typedefs, structures, and compiler characteristics.
+ac_fn_c_check_type "$LINENO" "_Bool" "ac_cv_type__Bool" "$ac_includes_default"
+if test "x$ac_cv_type__Bool" = xyes
+then :
+printf "%s\n" "#define HAVE__BOOL 1" >>confdefs.h
-for ac_header in fcntl.h memory.h stdint.h stdlib.h string.h strings.h sys/ioctl.h sys/param.h unistd.h stddef.h
-do :
- as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh`
-ac_fn_c_check_header_mongrel "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default"
-if eval test \"x\$"$as_ac_Header"\" = x"yes"; then :
- cat >>confdefs.h <<_ACEOF
-#define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1
-_ACEOF
fi
-done
-
-
-# Checks for typedefs, structures, and compiler characteristics.
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for stdbool.h that conforms to C99" >&5
-$as_echo_n "checking for stdbool.h that conforms to C99... " >&6; }
-if ${ac_cv_header_stdbool_h+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for stdbool.h that conforms to C99" >&5
+printf %s "checking for stdbool.h that conforms to C99... " >&6; }
+if test ${ac_cv_header_stdbool_h+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
+#include
- #include
- #ifndef bool
- "error: bool is not defined"
- #endif
- #ifndef false
- "error: false is not defined"
- #endif
- #if false
- "error: false is not 0"
+ #ifndef __bool_true_false_are_defined
+ #error "__bool_true_false_are_defined is not defined"
#endif
- #ifndef true
- "error: true is not defined"
+ char a[__bool_true_false_are_defined == 1 ? 1 : -1];
+
+ /* Regardless of whether this is C++ or "_Bool" is a
+ valid type name, "true" and "false" should be usable
+ in #if expressions and integer constant expressions,
+ and "bool" should be a valid type name. */
+
+ #if !true
+ #error "'true' is not true"
#endif
#if true != 1
- "error: true is not 1"
+ #error "'true' is not equal to 1"
#endif
- #ifndef __bool_true_false_are_defined
- "error: __bool_true_false_are_defined is not defined"
+ char b[true == 1 ? 1 : -1];
+ char c[true];
+
+ #if false
+ #error "'false' is not false"
#endif
+ #if false != 0
+ #error "'false' is not equal to 0"
+ #endif
+ char d[false == 0 ? 1 : -1];
+
+ enum { e = false, f = true, g = false * true, h = true * 256 };
+
+ char i[(bool) 0.5 == true ? 1 : -1];
+ char j[(bool) 0.0 == false ? 1 : -1];
+ char k[sizeof (bool) > 0 ? 1 : -1];
+
+ struct sb { bool s: 1; bool t; } s;
+ char l[sizeof s.t > 0 ? 1 : -1];
- struct s { _Bool s: 1; _Bool t; } s;
-
- char a[true == 1 ? 1 : -1];
- char b[false == 0 ? 1 : -1];
- char c[__bool_true_false_are_defined == 1 ? 1 : -1];
- char d[(bool) 0.5 == true ? 1 : -1];
- /* See body of main program for 'e'. */
- char f[(_Bool) 0.0 == false ? 1 : -1];
- char g[true];
- char h[sizeof (_Bool)];
- char i[sizeof s.t];
- enum { j = false, k = true, l = false * true, m = true * 256 };
/* The following fails for
HP aC++/ANSI C B3910B A.05.55 [Dec 04 2003]. */
- _Bool n[m];
- char o[sizeof n == m * sizeof n[0] ? 1 : -1];
- char p[-1 - (_Bool) 0 < 0 && -1 - (bool) 0 < 0 ? 1 : -1];
+ bool m[h];
+ char n[sizeof m == h * sizeof m[0] ? 1 : -1];
+ char o[-1 - (bool) 0 < 0 ? 1 : -1];
/* Catch a bug in an HP-UX C compiler. See
- http://gcc.gnu.org/ml/gcc-patches/2003-12/msg02303.html
- http://lists.gnu.org/archive/html/bug-coreutils/2005-11/msg00161.html
+ https://gcc.gnu.org/ml/gcc-patches/2003-12/msg02303.html
+ https://lists.gnu.org/archive/html/bug-coreutils/2005-11/msg00161.html
*/
- _Bool q = true;
- _Bool *pq = &q;
+ bool p = true;
+ bool *pp = &p;
+
+ /* C 1999 specifies that bool, true, and false are to be
+ macros, but C++ 2011 and later overrule this. */
+ #if __cplusplus < 201103
+ #ifndef bool
+ #error "bool is not defined"
+ #endif
+ #ifndef false
+ #error "false is not defined"
+ #endif
+ #ifndef true
+ #error "true is not defined"
+ #endif
+ #endif
+
+ /* If _Bool is available, repeat with it all the tests
+ above that used bool. */
+ #ifdef HAVE__BOOL
+ struct sB { _Bool s: 1; _Bool t; } t;
+
+ char q[(_Bool) 0.5 == true ? 1 : -1];
+ char r[(_Bool) 0.0 == false ? 1 : -1];
+ char u[sizeof (_Bool) > 0 ? 1 : -1];
+ char v[sizeof t.t > 0 ? 1 : -1];
+
+ _Bool w[h];
+ char x[sizeof m == h * sizeof m[0] ? 1 : -1];
+ char y[-1 - (_Bool) 0 < 0 ? 1 : -1];
+ _Bool z = true;
+ _Bool *pz = &p;
+ #endif
int
-main ()
+main (void)
{
- bool e = &s;
- *pq |= q;
- *pq |= ! q;
- /* Refer to every declared value, to avoid compiler optimizations. */
- return (!a + !b + !c + !d + !e + !f + !g + !h + !i + !!j + !k + !!l
- + !m + !n + !o + !p + !q + !pq);
+ bool ps = &s;
+ *pp |= p;
+ *pp |= ! p;
+
+ #ifdef HAVE__BOOL
+ _Bool pt = &t;
+ *pz |= z;
+ *pz |= ! z;
+ #endif
+
+ /* Refer to every declared value, so they cannot be
+ discarded as unused. */
+ return (!a + !b + !c + !d + !e + !f + !g + !h + !i + !j + !k
+ + !l + !m + !n + !o + !p + !pp + !ps
+ #ifdef HAVE__BOOL
+ + !q + !r + !u + !v + !w + !x + !y + !z + !pt
+ #endif
+ );
;
return 0;
}
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
ac_cv_header_stdbool_h=yes
-else
+else $as_nop
ac_cv_header_stdbool_h=no
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdbool_h" >&5
-$as_echo "$ac_cv_header_stdbool_h" >&6; }
- ac_fn_c_check_type "$LINENO" "_Bool" "ac_cv_type__Bool" "$ac_includes_default"
-if test "x$ac_cv_type__Bool" = xyes; then :
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdbool_h" >&5
+printf "%s\n" "$ac_cv_header_stdbool_h" >&6; }
-cat >>confdefs.h <<_ACEOF
-#define HAVE__BOOL 1
-_ACEOF
-
-
-fi
-
-
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for inline" >&5
-$as_echo_n "checking for inline... " >&6; }
-if ${ac_cv_c_inline+:} false; then :
- $as_echo_n "(cached) " >&6
-else
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for inline" >&5
+printf %s "checking for inline... " >&6; }
+if test ${ac_cv_c_inline+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
ac_cv_c_inline=no
for ac_kw in inline __inline__ __inline; do
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
#ifndef __cplusplus
typedef int foo_t;
-static $ac_kw foo_t static_foo () {return 0; }
-$ac_kw foo_t foo () {return 0; }
+static $ac_kw foo_t static_foo (void) {return 0; }
+$ac_kw foo_t foo (void) {return 0; }
#endif
_ACEOF
-if ac_fn_c_try_compile "$LINENO"; then :
+if ac_fn_c_try_compile "$LINENO"
+then :
ac_cv_c_inline=$ac_kw
fi
-rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext
test "$ac_cv_c_inline" != no && break
done
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_inline" >&5
-$as_echo "$ac_cv_c_inline" >&6; }
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_inline" >&5
+printf "%s\n" "$ac_cv_c_inline" >&6; }
case $ac_cv_c_inline in
inline | yes) ;;
@@ -4382,24 +4967,22 @@ _ACEOF
esac
ac_fn_c_check_type "$LINENO" "size_t" "ac_cv_type_size_t" "$ac_includes_default"
-if test "x$ac_cv_type_size_t" = xyes; then :
+if test "x$ac_cv_type_size_t" = xyes
+then :
-else
+else $as_nop
-cat >>confdefs.h <<_ACEOF
-#define size_t unsigned int
-_ACEOF
+printf "%s\n" "#define size_t unsigned int" >>confdefs.h
fi
ac_fn_c_check_type "$LINENO" "ssize_t" "ac_cv_type_ssize_t" "$ac_includes_default"
-if test "x$ac_cv_type_ssize_t" = xyes; then :
+if test "x$ac_cv_type_ssize_t" = xyes
+then :
-else
+else $as_nop
-cat >>confdefs.h <<_ACEOF
-#define ssize_t int
-_ACEOF
+printf "%s\n" "#define ssize_t int" >>confdefs.h
fi
@@ -4409,9 +4992,7 @@ case $ac_cv_c_uint16_t in #(
*)
-cat >>confdefs.h <<_ACEOF
-#define uint16_t $ac_cv_c_uint16_t
-_ACEOF
+printf "%s\n" "#define uint16_t $ac_cv_c_uint16_t" >>confdefs.h
;;
esac
@@ -4420,12 +5001,10 @@ case $ac_cv_c_uint32_t in #(
no|yes) ;; #(
*)
-$as_echo "#define _UINT32_T 1" >>confdefs.h
+printf "%s\n" "#define _UINT32_T 1" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define uint32_t $ac_cv_c_uint32_t
-_ACEOF
+printf "%s\n" "#define uint32_t $ac_cv_c_uint32_t" >>confdefs.h
;;
esac
@@ -4434,12 +5013,10 @@ case $ac_cv_c_uint64_t in #(
no|yes) ;; #(
*)
-$as_echo "#define _UINT64_T 1" >>confdefs.h
+printf "%s\n" "#define _UINT64_T 1" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define uint64_t $ac_cv_c_uint64_t
-_ACEOF
+printf "%s\n" "#define uint64_t $ac_cv_c_uint64_t" >>confdefs.h
;;
esac
@@ -4448,12 +5025,10 @@ case $ac_cv_c_uint8_t in #(
no|yes) ;; #(
*)
-$as_echo "#define _UINT8_T 1" >>confdefs.h
+printf "%s\n" "#define _UINT8_T 1" >>confdefs.h
-cat >>confdefs.h <<_ACEOF
-#define uint8_t $ac_cv_c_uint8_t
-_ACEOF
+printf "%s\n" "#define uint8_t $ac_cv_c_uint8_t" >>confdefs.h
;;
esac
@@ -4462,9 +5037,7 @@ case $ac_cv_c_int16_t in #(
no|yes) ;; #(
*)
-cat >>confdefs.h <<_ACEOF
-#define int16_t $ac_cv_c_int16_t
-_ACEOF
+printf "%s\n" "#define int16_t $ac_cv_c_int16_t" >>confdefs.h
;;
esac
@@ -4473,53 +5046,123 @@ case $ac_cv_c_int32_t in #(
no|yes) ;; #(
*)
-cat >>confdefs.h <<_ACEOF
-#define int32_t $ac_cv_c_int32_t
-_ACEOF
+printf "%s\n" "#define int32_t $ac_cv_c_int32_t" >>confdefs.h
;;
esac
# Checks for library functions.
-for ac_header in stdlib.h
-do :
- ac_fn_c_check_header_mongrel "$LINENO" "stdlib.h" "ac_cv_header_stdlib_h" "$ac_includes_default"
-if test "x$ac_cv_header_stdlib_h" = xyes; then :
- cat >>confdefs.h <<_ACEOF
-#define HAVE_STDLIB_H 1
-_ACEOF
-
-fi
-done
-{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for GNU libc compatible malloc" >&5
-$as_echo_n "checking for GNU libc compatible malloc... " >&6; }
-if ${ac_cv_func_malloc_0_nonnull+:} false; then :
- $as_echo_n "(cached) " >&6
-else
- if test "$cross_compiling" = yes; then :
- ac_cv_func_malloc_0_nonnull=no
-else
+ # Make sure we can run config.sub.
+$SHELL "${ac_aux_dir}config.sub" sun4 >/dev/null 2>&1 ||
+ as_fn_error $? "cannot run $SHELL ${ac_aux_dir}config.sub" "$LINENO" 5
+
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking build system type" >&5
+printf %s "checking build system type... " >&6; }
+if test ${ac_cv_build+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ ac_build_alias=$build_alias
+test "x$ac_build_alias" = x &&
+ ac_build_alias=`$SHELL "${ac_aux_dir}config.guess"`
+test "x$ac_build_alias" = x &&
+ as_fn_error $? "cannot guess build type; you must specify one" "$LINENO" 5
+ac_cv_build=`$SHELL "${ac_aux_dir}config.sub" $ac_build_alias` ||
+ as_fn_error $? "$SHELL ${ac_aux_dir}config.sub $ac_build_alias failed" "$LINENO" 5
+
+fi
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_build" >&5
+printf "%s\n" "$ac_cv_build" >&6; }
+case $ac_cv_build in
+*-*-*) ;;
+*) as_fn_error $? "invalid value of canonical build" "$LINENO" 5;;
+esac
+build=$ac_cv_build
+ac_save_IFS=$IFS; IFS='-'
+set x $ac_cv_build
+shift
+build_cpu=$1
+build_vendor=$2
+shift; shift
+# Remember, the first character of IFS is used to create $*,
+# except with old shells:
+build_os=$*
+IFS=$ac_save_IFS
+case $build_os in *\ *) build_os=`echo "$build_os" | sed 's/ /-/g'`;; esac
+
+
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking host system type" >&5
+printf %s "checking host system type... " >&6; }
+if test ${ac_cv_host+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ if test "x$host_alias" = x; then
+ ac_cv_host=$ac_cv_build
+else
+ ac_cv_host=`$SHELL "${ac_aux_dir}config.sub" $host_alias` ||
+ as_fn_error $? "$SHELL ${ac_aux_dir}config.sub $host_alias failed" "$LINENO" 5
+fi
+
+fi
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_host" >&5
+printf "%s\n" "$ac_cv_host" >&6; }
+case $ac_cv_host in
+*-*-*) ;;
+*) as_fn_error $? "invalid value of canonical host" "$LINENO" 5;;
+esac
+host=$ac_cv_host
+ac_save_IFS=$IFS; IFS='-'
+set x $ac_cv_host
+shift
+host_cpu=$1
+host_vendor=$2
+shift; shift
+# Remember, the first character of IFS is used to create $*,
+# except with old shells:
+host_os=$*
+IFS=$ac_save_IFS
+case $host_os in *\ *) host_os=`echo "$host_os" | sed 's/ /-/g'`;; esac
+
+
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for GNU libc compatible malloc" >&5
+printf %s "checking for GNU libc compatible malloc... " >&6; }
+if test ${ac_cv_func_malloc_0_nonnull+y}
+then :
+ printf %s "(cached) " >&6
+else $as_nop
+ if test "$cross_compiling" = yes
+then :
+ case "$host_os" in # ((
+ # Guess yes on platforms where we know the result.
+ *-gnu* | freebsd* | netbsd* | openbsd* | bitrig* \
+ | hpux* | solaris* | cygwin* | mingw* | msys* )
+ ac_cv_func_malloc_0_nonnull=yes ;;
+ # If we don't know, assume the worst.
+ *) ac_cv_func_malloc_0_nonnull=no ;;
+ esac
+else $as_nop
cat confdefs.h - <<_ACEOF >conftest.$ac_ext
/* end confdefs.h. */
-#if defined STDC_HEADERS || defined HAVE_STDLIB_H
-# include
-#else
-char *malloc ();
-#endif
+#include
int
-main ()
+main (void)
{
-return ! malloc (0);
+void *p = malloc (0);
+ int result = !p;
+ free (p);
+ return result;
;
return 0;
}
_ACEOF
-if ac_fn_c_try_run "$LINENO"; then :
+if ac_fn_c_try_run "$LINENO"
+then :
ac_cv_func_malloc_0_nonnull=yes
-else
+else $as_nop
ac_cv_func_malloc_0_nonnull=no
fi
rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \
@@ -4527,14 +5170,15 @@ rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \
fi
fi
-{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_func_malloc_0_nonnull" >&5
-$as_echo "$ac_cv_func_malloc_0_nonnull" >&6; }
-if test $ac_cv_func_malloc_0_nonnull = yes; then :
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_func_malloc_0_nonnull" >&5
+printf "%s\n" "$ac_cv_func_malloc_0_nonnull" >&6; }
+if test $ac_cv_func_malloc_0_nonnull = yes
+then :
-$as_echo "#define HAVE_MALLOC 1" >>confdefs.h
+printf "%s\n" "#define HAVE_MALLOC 1" >>confdefs.h
-else
- $as_echo "#define HAVE_MALLOC 0" >>confdefs.h
+else $as_nop
+ printf "%s\n" "#define HAVE_MALLOC 0" >>confdefs.h
case " $LIBOBJS " in
*" malloc.$ac_objext "* ) ;;
@@ -4543,22 +5187,23 @@ else
esac
-$as_echo "#define malloc rpl_malloc" >>confdefs.h
+printf "%s\n" "#define malloc rpl_malloc" >>confdefs.h
fi
-for ac_func in memset strerror
-do :
- as_ac_var=`$as_echo "ac_cv_func_$ac_func" | $as_tr_sh`
-ac_fn_c_check_func "$LINENO" "$ac_func" "$as_ac_var"
-if eval test \"x\$"$as_ac_var"\" = x"yes"; then :
- cat >>confdefs.h <<_ACEOF
-#define `$as_echo "HAVE_$ac_func" | $as_tr_cpp` 1
-_ACEOF
+ac_fn_c_check_func "$LINENO" "memset" "ac_cv_func_memset"
+if test "x$ac_cv_func_memset" = xyes
+then :
+ printf "%s\n" "#define HAVE_MEMSET 1" >>confdefs.h
+
+fi
+ac_fn_c_check_func "$LINENO" "strerror" "ac_cv_func_strerror"
+if test "x$ac_cv_func_strerror" = xyes
+then :
+ printf "%s\n" "#define HAVE_STRERROR 1" >>confdefs.h
fi
-done
ac_config_files="$ac_config_files Makefile src/Makefile"
@@ -4590,8 +5235,8 @@ _ACEOF
case $ac_val in #(
*${as_nl}*)
case $ac_var in #(
- *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
-$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
+ *_cv_*) { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5
+printf "%s\n" "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
esac
case $ac_var in #(
_ | IFS | as_nl) ;; #(
@@ -4621,15 +5266,15 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;;
/^ac_cv_env_/b end
t clear
:clear
- s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/
+ s/^\([^=]*\)=\(.*[{}].*\)$/test ${\1+y} || &/
t end
s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/
:end' >>confcache
if diff "$cache_file" confcache >/dev/null 2>&1; then :; else
if test -w "$cache_file"; then
if test "x$cache_file" != "x/dev/null"; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5
-$as_echo "$as_me: updating cache $cache_file" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5
+printf "%s\n" "$as_me: updating cache $cache_file" >&6;}
if test ! -f "$cache_file" || test -h "$cache_file"; then
cat confcache >"$cache_file"
else
@@ -4643,8 +5288,8 @@ $as_echo "$as_me: updating cache $cache_file" >&6;}
fi
fi
else
- { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5
-$as_echo "$as_me: not updating unwritable cache $cache_file" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5
+printf "%s\n" "$as_me: not updating unwritable cache $cache_file" >&6;}
fi
fi
rm -f confcache
@@ -4661,7 +5306,7 @@ U=
for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue
# 1. Remove the extension, and $U if already installed.
ac_script='s/\$U\././;s/\.o$//;s/\.obj$//'
- ac_i=`$as_echo "$ac_i" | sed "$ac_script"`
+ ac_i=`printf "%s\n" "$ac_i" | sed "$ac_script"`
# 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR
# will be set to the directory where LIBOBJS objects are built.
as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext"
@@ -4677,8 +5322,8 @@ LTLIBOBJS=$ac_ltlibobjs
ac_write_fail=0
ac_clean_files_save=$ac_clean_files
ac_clean_files="$ac_clean_files $CONFIG_STATUS"
-{ $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5
-$as_echo "$as_me: creating $CONFIG_STATUS" >&6;}
+{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5
+printf "%s\n" "$as_me: creating $CONFIG_STATUS" >&6;}
as_write_fail=0
cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1
#! $SHELL
@@ -4701,14 +5346,16 @@ cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1
# Be more Bourne compatible
DUALCASE=1; export DUALCASE # for MKS sh
-if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then :
+as_nop=:
+if test ${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1
+then :
emulate sh
NULLCMD=:
# Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which
# is contrary to our usage. Disable this feature.
alias -g '${1+"$@"}'='"$@"'
setopt NO_GLOB_SUBST
-else
+else $as_nop
case `(set -o) 2>/dev/null` in #(
*posix*) :
set -o posix ;; #(
@@ -4718,46 +5365,46 @@ esac
fi
+
+# Reset variables that may have inherited troublesome values from
+# the environment.
+
+# IFS needs to be set, to space, tab, and newline, in precisely that order.
+# (If _AS_PATH_WALK were called with IFS unset, it would have the
+# side effect of setting IFS to empty, thus disabling word splitting.)
+# Quoting is to prevent editors from complaining about space-tab.
as_nl='
'
export as_nl
-# Printing a long string crashes Solaris 7 /usr/bin/printf.
-as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\'
-as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo
-as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo
-# Prefer a ksh shell builtin over an external printf program on Solaris,
-# but without wasting forks for bash or zsh.
-if test -z "$BASH_VERSION$ZSH_VERSION" \
- && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then
- as_echo='print -r --'
- as_echo_n='print -rn --'
-elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then
- as_echo='printf %s\n'
- as_echo_n='printf %s'
-else
- if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then
- as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"'
- as_echo_n='/usr/ucb/echo -n'
- else
- as_echo_body='eval expr "X$1" : "X\\(.*\\)"'
- as_echo_n_body='eval
- arg=$1;
- case $arg in #(
- *"$as_nl"*)
- expr "X$arg" : "X\\(.*\\)$as_nl";
- arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;;
- esac;
- expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl"
- '
- export as_echo_n_body
- as_echo_n='sh -c $as_echo_n_body as_echo'
- fi
- export as_echo_body
- as_echo='sh -c $as_echo_body as_echo'
-fi
+IFS=" "" $as_nl"
+
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# Ensure predictable behavior from utilities with locale-dependent output.
+LC_ALL=C
+export LC_ALL
+LANGUAGE=C
+export LANGUAGE
+
+# We cannot yet rely on "unset" to work, but we need these variables
+# to be unset--not just set to an empty or harmless value--now, to
+# avoid bugs in old shells (e.g. pre-3.0 UWIN ksh). This construct
+# also avoids known problems related to "unset" and subshell syntax
+# in other old shells (e.g. bash 2.01 and pdksh 5.2.14).
+for as_var in BASH_ENV ENV MAIL MAILPATH CDPATH
+do eval test \${$as_var+y} \
+ && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
+done
+
+# Ensure that fds 0, 1, and 2 are open.
+if (exec 3>&0) 2>/dev/null; then :; else exec 0&1) 2>/dev/null; then :; else exec 1>/dev/null; fi
+if (exec 3>&2) ; then :; else exec 2>/dev/null; fi
# The user is always right.
-if test "${PATH_SEPARATOR+set}" != set; then
+if ${PATH_SEPARATOR+false} :; then
PATH_SEPARATOR=:
(PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && {
(PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 ||
@@ -4766,13 +5413,6 @@ if test "${PATH_SEPARATOR+set}" != set; then
fi
-# IFS
-# We need space, tab and new line, in precisely that order. Quoting is
-# there to prevent editors from complaining about space-tab.
-# (If _AS_PATH_WALK were called with IFS unset, it would disable word
-# splitting by setting IFS to empty value.)
-IFS=" "" $as_nl"
-
# Find who we are. Look in the path if we contain no directory separator.
as_myself=
case $0 in #((
@@ -4781,8 +5421,12 @@ case $0 in #((
for as_dir in $PATH
do
IFS=$as_save_IFS
- test -z "$as_dir" && as_dir=.
- test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+ case $as_dir in #(((
+ '') as_dir=./ ;;
+ */) ;;
+ *) as_dir=$as_dir/ ;;
+ esac
+ test -r "$as_dir$0" && as_myself=$as_dir$0 && break
done
IFS=$as_save_IFS
@@ -4794,30 +5438,10 @@ if test "x$as_myself" = x; then
as_myself=$0
fi
if test ! -f "$as_myself"; then
- $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ printf "%s\n" "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
exit 1
fi
-# Unset variables that we do not need and which cause bugs (e.g. in
-# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1"
-# suppresses any "Segmentation fault" message there. '((' could
-# trigger a bug in pdksh 5.2.14.
-for as_var in BASH_ENV ENV MAIL MAILPATH
-do eval test x\${$as_var+set} = xset \
- && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || :
-done
-PS1='$ '
-PS2='> '
-PS4='+ '
-
-# NLS nuisances.
-LC_ALL=C
-export LC_ALL
-LANGUAGE=C
-export LANGUAGE
-
-# CDPATH.
-(unset CDPATH) >/dev/null 2>&1 && unset CDPATH
# as_fn_error STATUS ERROR [LINENO LOG_FD]
@@ -4830,13 +5454,14 @@ as_fn_error ()
as_status=$1; test $as_status -eq 0 && as_status=1
if test "$4"; then
as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack
- $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
+ printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: $2" >&$4
fi
- $as_echo "$as_me: error: $2" >&2
+ printf "%s\n" "$as_me: error: $2" >&2
as_fn_exit $as_status
} # as_fn_error
+
# as_fn_set_status STATUS
# -----------------------
# Set $? to STATUS, without forking.
@@ -4863,18 +5488,20 @@ as_fn_unset ()
{ eval $1=; unset $1;}
}
as_unset=as_fn_unset
+
# as_fn_append VAR VALUE
# ----------------------
# Append the text in VALUE to the end of the definition contained in VAR. Take
# advantage of any shell optimizations that allow amortized linear growth over
# repeated appends, instead of the typical quadratic growth present in naive
# implementations.
-if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then :
+if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null
+then :
eval 'as_fn_append ()
{
eval $1+=\$2
}'
-else
+else $as_nop
as_fn_append ()
{
eval $1=\$$1\$2
@@ -4886,12 +5513,13 @@ fi # as_fn_append
# Perform arithmetic evaluation on the ARGs, and store the result in the
# global $as_val. Take advantage of shells that can avoid forks. The arguments
# must be portable across $(()) and expr.
-if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then :
+if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null
+then :
eval 'as_fn_arith ()
{
as_val=$(( $* ))
}'
-else
+else $as_nop
as_fn_arith ()
{
as_val=`expr "$@" || test $? -eq 1`
@@ -4922,7 +5550,7 @@ as_me=`$as_basename -- "$0" ||
$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
X"$0" : 'X\(//\)$' \| \
X"$0" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X/"$0" |
+printf "%s\n" X/"$0" |
sed '/^.*\/\([^/][^/]*\)\/*$/{
s//\1/
q
@@ -4944,6 +5572,10 @@ as_cr_Letters=$as_cr_letters$as_cr_LETTERS
as_cr_digits='0123456789'
as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+# Determine whether it's possible to make 'echo' print without a newline.
+# These variables are no longer used directly by Autoconf, but are AC_SUBSTed
+# for compatibility with existing Makefiles.
ECHO_C= ECHO_N= ECHO_T=
case `echo -n x` in #(((((
-n*)
@@ -4957,6 +5589,12 @@ case `echo -n x` in #(((((
ECHO_N='-n';;
esac
+# For backward compatibility with old third-party macros, we provide
+# the shell variables $as_echo and $as_echo_n. New code should use
+# AS_ECHO(["message"]) and AS_ECHO_N(["message"]), respectively.
+as_echo='printf %s\n'
+as_echo_n='printf %s'
+
rm -f conf$$ conf$$.exe conf$$.file
if test -d conf$$.dir; then
rm -f conf$$.dir/conf$$.file
@@ -4998,7 +5636,7 @@ as_fn_mkdir_p ()
as_dirs=
while :; do
case $as_dir in #(
- *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
+ *\'*) as_qdir=`printf "%s\n" "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'(
*) as_qdir=$as_dir;;
esac
as_dirs="'$as_qdir' $as_dirs"
@@ -5007,7 +5645,7 @@ $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
X"$as_dir" : 'X\(//\)[^/]' \| \
X"$as_dir" : 'X\(//\)$' \| \
X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X"$as_dir" |
+printf "%s\n" X"$as_dir" |
sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
s//\1/
q
@@ -5069,8 +5707,8 @@ cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1
# report actual input values of CONFIG_FILES etc. instead of their
# values after options handling.
ac_log="
-This file was extended by seedtool-cli $as_me 0.10.2, which was
-generated by GNU Autoconf 2.69. Invocation command line was
+This file was extended by seedtool-cli $as_me 0.11.0, which was
+generated by GNU Autoconf 2.71. Invocation command line was
CONFIG_FILES = $CONFIG_FILES
CONFIG_HEADERS = $CONFIG_HEADERS
@@ -5128,14 +5766,16 @@ $config_headers
Report bugs to the package provider."
_ACEOF
+ac_cs_config=`printf "%s\n" "$ac_configure_args" | sed "$ac_safe_unquote"`
+ac_cs_config_escaped=`printf "%s\n" "$ac_cs_config" | sed "s/^ //; s/'/'\\\\\\\\''/g"`
cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
-ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`"
+ac_cs_config='$ac_cs_config_escaped'
ac_cs_version="\\
-seedtool-cli config.status 0.10.2
-configured by $0, generated by GNU Autoconf 2.69,
+seedtool-cli config.status 0.11.0
+configured by $0, generated by GNU Autoconf 2.71,
with options \\"\$ac_cs_config\\"
-Copyright (C) 2012 Free Software Foundation, Inc.
+Copyright (C) 2021 Free Software Foundation, Inc.
This config.status script is free software; the Free Software Foundation
gives unlimited permission to copy, distribute and modify it."
@@ -5173,15 +5813,15 @@ do
-recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r)
ac_cs_recheck=: ;;
--version | --versio | --versi | --vers | --ver | --ve | --v | -V )
- $as_echo "$ac_cs_version"; exit ;;
+ printf "%s\n" "$ac_cs_version"; exit ;;
--config | --confi | --conf | --con | --co | --c )
- $as_echo "$ac_cs_config"; exit ;;
+ printf "%s\n" "$ac_cs_config"; exit ;;
--debug | --debu | --deb | --de | --d | -d )
debug=: ;;
--file | --fil | --fi | --f )
$ac_shift
case $ac_optarg in
- *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ *\'*) ac_optarg=`printf "%s\n" "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
'') as_fn_error $? "missing file argument" ;;
esac
as_fn_append CONFIG_FILES " '$ac_optarg'"
@@ -5189,7 +5829,7 @@ do
--header | --heade | --head | --hea )
$ac_shift
case $ac_optarg in
- *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ *\'*) ac_optarg=`printf "%s\n" "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;;
esac
as_fn_append CONFIG_HEADERS " '$ac_optarg'"
ac_need_defaults=false;;
@@ -5198,7 +5838,7 @@ do
as_fn_error $? "ambiguous option: \`$1'
Try \`$0 --help' for more information.";;
--help | --hel | -h )
- $as_echo "$ac_cs_usage"; exit ;;
+ printf "%s\n" "$ac_cs_usage"; exit ;;
-q | -quiet | --quiet | --quie | --qui | --qu | --q \
| -silent | --silent | --silen | --sile | --sil | --si | --s)
ac_cs_silent=: ;;
@@ -5226,7 +5866,7 @@ cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
if \$ac_cs_recheck; then
set X $SHELL '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion
shift
- \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6
+ \printf "%s\n" "running CONFIG_SHELL=$SHELL \$*" >&6
CONFIG_SHELL='$SHELL'
export CONFIG_SHELL
exec "\$@"
@@ -5240,7 +5880,7 @@ exec 5>>config.log
sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX
## Running $as_me. ##
_ASBOX
- $as_echo "$ac_log"
+ printf "%s\n" "$ac_log"
} >&5
_ACEOF
@@ -5267,8 +5907,8 @@ done
# We use the long form for the default assignment because of an extremely
# bizarre bug on SunOS 4.1.3.
if $ac_need_defaults; then
- test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files
- test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers
+ test ${CONFIG_FILES+y} || CONFIG_FILES=$config_files
+ test ${CONFIG_HEADERS+y} || CONFIG_HEADERS=$config_headers
fi
# Have a temporary directory for convenience. Make it in the build tree
@@ -5604,7 +6244,7 @@ do
esac ||
as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;;
esac
- case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac
+ case $ac_f in *\'*) ac_f=`printf "%s\n" "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac
as_fn_append ac_file_inputs " '$ac_f'"
done
@@ -5612,17 +6252,17 @@ do
# use $as_me), people would be surprised to read:
# /* config.h. Generated by config.status. */
configure_input='Generated from '`
- $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g'
+ printf "%s\n" "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g'
`' by configure.'
if test x"$ac_file" != x-; then
configure_input="$ac_file. $configure_input"
- { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5
-$as_echo "$as_me: creating $ac_file" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5
+printf "%s\n" "$as_me: creating $ac_file" >&6;}
fi
# Neutralize special characters interpreted by sed in replacement strings.
case $configure_input in #(
*\&* | *\|* | *\\* )
- ac_sed_conf_input=`$as_echo "$configure_input" |
+ ac_sed_conf_input=`printf "%s\n" "$configure_input" |
sed 's/[\\\\&|]/\\\\&/g'`;; #(
*) ac_sed_conf_input=$configure_input;;
esac
@@ -5639,7 +6279,7 @@ $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
X"$ac_file" : 'X\(//\)[^/]' \| \
X"$ac_file" : 'X\(//\)$' \| \
X"$ac_file" : 'X\(/\)' \| . 2>/dev/null ||
-$as_echo X"$ac_file" |
+printf "%s\n" X"$ac_file" |
sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
s//\1/
q
@@ -5663,9 +6303,9 @@ $as_echo X"$ac_file" |
case "$ac_dir" in
.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
*)
- ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'`
+ ac_dir_suffix=/`printf "%s\n" "$ac_dir" | sed 's|^\.[\\/]||'`
# A ".." for each directory in $ac_dir_suffix.
- ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
+ ac_top_builddir_sub=`printf "%s\n" "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'`
case $ac_top_builddir_sub in
"") ac_top_builddir_sub=. ac_top_build_prefix= ;;
*) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
@@ -5722,8 +6362,8 @@ ac_sed_dataroot='
case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in
*datarootdir*) ac_datarootdir_seen=yes;;
*@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*)
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5
-$as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5
+printf "%s\n" "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;}
_ACEOF
cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1
ac_datarootdir_hack='
@@ -5766,9 +6406,9 @@ test -z "$ac_datarootdir_hack$ac_datarootdir_seen" &&
{ ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } &&
{ ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \
"$ac_tmp/out"`; test -z "$ac_out"; } &&
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir'
which seems to be undefined. Please make sure it is defined" >&5
-$as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+printf "%s\n" "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir'
which seems to be undefined. Please make sure it is defined" >&2;}
rm -f "$ac_tmp/stdin"
@@ -5784,20 +6424,20 @@ which seems to be undefined. Please make sure it is defined" >&2;}
#
if test x"$ac_file" != x-; then
{
- $as_echo "/* $configure_input */" \
+ printf "%s\n" "/* $configure_input */" >&1 \
&& eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs"
} >"$ac_tmp/config.h" \
|| as_fn_error $? "could not create $ac_file" "$LINENO" 5
if diff "$ac_file" "$ac_tmp/config.h" >/dev/null 2>&1; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5
-$as_echo "$as_me: $ac_file is unchanged" >&6;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5
+printf "%s\n" "$as_me: $ac_file is unchanged" >&6;}
else
rm -f "$ac_file"
mv "$ac_tmp/config.h" "$ac_file" \
|| as_fn_error $? "could not create $ac_file" "$LINENO" 5
fi
else
- $as_echo "/* $configure_input */" \
+ printf "%s\n" "/* $configure_input */" >&1 \
&& eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" \
|| as_fn_error $? "could not create -" "$LINENO" 5
fi
@@ -5838,7 +6478,8 @@ if test "$no_create" != yes; then
$ac_cs_success || as_fn_exit 1
fi
if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then
- { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5
-$as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;}
+ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5
+printf "%s\n" "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;}
fi
+
diff --git a/configure.ac b/configure.ac
index 8f33009..c24da66 100644
--- a/configure.ac
+++ b/configure.ac
@@ -2,9 +2,10 @@
# Process this file with autoconf to produce a configure script.
AC_PREREQ([2.69])
-AC_INIT([seedtool-cli], [0.10.2])
+AC_INIT([seedtool-cli], [0.11.0])
AC_CONFIG_SRCDIR([src/seedtool.cpp])
AC_CONFIG_HEADERS([src/config.h])
+AC_CONFIG_AUX_DIR([build-aux])
# Checks for programs.
AC_PROG_CXX
diff --git a/src/config.h.in b/src/config.h.in
index 53dfd94..42f5fc9 100644
--- a/src/config.h.in
+++ b/src/config.h.in
@@ -40,6 +40,9 @@
/* Define to 1 if you have the header file. */
#undef HAVE_STDINT_H
+/* Define to 1 if you have the header file. */
+#undef HAVE_STDIO_H
+
/* Define to 1 if you have the header file. */
#undef HAVE_STDLIB_H
@@ -88,7 +91,9 @@
/* Define to the version of this package. */
#undef PACKAGE_VERSION
-/* Define to 1 if you have the ANSI C header files. */
+/* Define to 1 if all of the C90 standard headers exist (not just the ones
+ required in a freestanding environment). This macro is provided for
+ backward compatibility; new code need not use it. */
#undef STDC_HEADERS
/* Define for Solaris 2.5.1 so the uint32_t typedef from ,
diff --git a/src/format-hex.cpp b/src/format-hex.cpp
index 5fa8bde..dce2780 100644
--- a/src/format-hex.cpp
+++ b/src/format-hex.cpp
@@ -49,7 +49,7 @@ void FormatHex::process_output(Params* p) {
encode_byte_string(byte_string, p->seed);
ByteVector dict;
encode_dict_with_birthdate(dict, byte_string, false);
- p->set_ur_output(dict, "crypto-seed");
+ p->set_ur_output(dict, "seed");
} else {
p->output = data_to_hex(p->seed);
}
diff --git a/src/params.cpp b/src/params.cpp
index d974284..9e09087 100644
--- a/src/params.cpp
+++ b/src/params.cpp
@@ -313,7 +313,7 @@ void Params::validate_input() {
argp_error(state, "Incomplete UR parts.");
} else {
auto type = ur_shares.front().type();
- if(type == "crypto-seed") {
+ if(type == "seed" || type == "crypto-seed") {
input_format = new FormatHex();
} else if(type == "crypto-bip39") {
input_format = new FormatBIP39();
diff --git a/src/test.sh b/src/test.sh
index 8083f71..ad0e949 100755
--- a/src/test.sh
+++ b/src/test.sh
@@ -212,55 +212,55 @@ testInSSKR2Of3()
testOutUR()
{
# seedtool --deterministic TEST --ur
- assertEquals $'ur:crypto-seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb' \
+ assertEquals $'ur:seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb' \
"$(${SEEDTOOL} --ur)"
}
testInUR()
{
assertEquals $'9d347f841a4e2ce6bc886e1aee74d824' \
- "$(${SEEDTOOL} --in ur ur:crypto-seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb)"
+ "$(${SEEDTOOL} --in ur ur:seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb)"
}
testOutMultipartUR()
{
- assertEquals $'ur:crypto-seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs
-ur:crypto-seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd
-ur:crypto-seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft
-ur:crypto-seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs
-ur:crypto-seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe' \
+ assertEquals $'ur:seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs
+ur:seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd
+ur:seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft
+ur:seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs
+ur:seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe' \
"$(${SEEDTOOL} --count 400 --ur=100)"
}
testInMultipartUR()
{
assertEquals $'9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af41b0378c9d7a54e44ebdac8005d681e7c8a6a9aa47cc9543742d6765870cecb05a648ddd5aeaa865087ba12136d530798ee42613db336b6b9e0ac07ce2d922ab71e7555ae4ed9a9ff7457d5722854e70684fe4bb927b89f8e8336b6019e67b3116b86fed' \
- "$(${SEEDTOOL} --in ur 'ur:crypto-seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs' \
-'ur:crypto-seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd' \
-'ur:crypto-seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft' \
-'ur:crypto-seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs' \
-'ur:crypto-seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe')"
+ "$(${SEEDTOOL} --in ur 'ur:seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs' \
+'ur:seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd' \
+'ur:seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft' \
+'ur:seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs' \
+'ur:seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe')"
}
testOutFountainUR()
{
- assertEquals $'ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
-ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
-ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
-ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
-ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
-ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
-ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
-ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
-ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
-ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
-ur:crypto-seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti
-ur:crypto-seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg
-ur:crypto-seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk
-ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
-ur:crypto-seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb
-ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
-ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe' \
+ assertEquals $'ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr
+ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn
+ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest
+ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt
+ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki
+ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn
+ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl
+ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp
+ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk
+ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl
+ur:seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti
+ur:seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg
+ur:seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk
+ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk
+ur:seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb
+ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd
+ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe' \
"$(${SEEDTOOL} --count 300 --ur=50 --parts 10)"
}
@@ -268,16 +268,16 @@ testInFountainUR()
{
assertEquals $'9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af' \
"$(${SEEDTOOL} --in ur \
- 'ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn' \
- 'ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt' \
- 'ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki' \
- 'ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl' \
- 'ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp' \
- 'ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk' \
- 'ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl' \
- 'ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk' \
- 'ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd' \
- 'ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe')"
+ 'ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn' \
+ 'ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt' \
+ 'ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki' \
+ 'ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl' \
+ 'ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp' \
+ 'ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk' \
+ 'ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl' \
+ 'ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk' \
+ 'ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd' \
+ 'ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe')"
}
testOutSSKRUR()