diff --git a/.gitignore b/.gitignore index 79f2561..3d005f1 100644 --- a/.gitignore +++ b/.gitignore @@ -96,3 +96,6 @@ config.status configure.scan config.h sysroot/ +.vscode/configurationCache.log +.vscode/dryrun.log +.vscode/targets.log diff --git a/Docs/MANUAL.md b/Docs/MANUAL.md index 60d542c..bab8cd8 100644 --- a/Docs/MANUAL.md +++ b/Docs/MANUAL.md @@ -713,7 +713,7 @@ mirror reject rookie talk pudding throw happy era myth already payment owner ## Uniform Resources (URs) -Seedtool can encode and decode binary (hex) seeds, BIP39-encoded seeds, or SSKR-encoded shares in the Uniform Resource (UR) format. This format is defined in [BCR-0005: Uniform Resources (UR): Encoding Structured Binary Data for Transport in URIs and QR Codes](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0005-ur.md). The UR types supported for encoding and decoding are `crypto-seed`, `crypto-bip39` and `crypto-sskr`. These types are defined in [BCR-0006: Registry of Uniform Resource (UR) Types](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0006-urtypes.md). +Seedtool can encode and decode binary (hex) seeds, BIP39-encoded seeds, or SSKR-encoded shares in the Uniform Resource (UR) format. This format is defined in [BCR-0005: Uniform Resources (UR): Encoding Structured Binary Data for Transport in URIs and QR Codes](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0005-ur.md). The UR types supported for encoding and decoding are `seed`, `crypto-bip39` and `crypto-sskr`. These types are defined in [BCR-0006: Registry of Uniform Resource (UR) Types](https://github.com/BlockchainCommons/Research/blob/master/papers/bcr-0006-urtypes.md). To encode the result of `seedtool` as a UR, supply the `--ur[=MAX_PART_LENGTH]` command line option. `MAX_PART_LENGTH` is a positive integer that sets the maximum number of characters allowed in a UR part. If a UR cannot be completely encoded in `MAX_PART_LENGTH` or fewer characters, it will be split into a number of roughly equal parts small enough to fall below the `MAX_PART_LENGTH` limit. The default for `MAX_PART_LENGTH` is 2500, and can be set higher or lower. Since `MAX_PART_LENGTH` is optional, it *must* be supplied after an equal sign: @@ -721,12 +721,12 @@ To encode the result of `seedtool` as a UR, supply the `--ur[=MAX_PART_LENGTH]` # OK: $ seedtool --ur -ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro +ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro # OK, UR is still small enough to be encoded in one part $ seedtool --ur=500 -ur:crypto-seed/oyadgdheasgwhlglcelagovsfsrspywklansfdvadshlhl +ur:seed/oyadgdheasgwhlglcelagovsfsrspywklansfdvadshlhl # Illegal: Optional values must be defined using equal sign. @@ -742,7 +742,7 @@ seedtool: MAX_FRAGMENT_LENGTH must be >= 10. To decode a UR in one of the supported formats, use the UR input method `--in ur`. ``` -$ seedtool --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro +$ seedtool --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro 66e9060071faeaeed5d045363a868ef4 ``` @@ -750,7 +750,7 @@ As in other cases, input may be supplied on separate lines and terminated by `^D ``` $ seedtool --in ur -ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro +ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro ^D 66e9060071faeaeed5d045363a868ef4 ``` @@ -758,14 +758,14 @@ ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro As with other input and output methods, seedtool operates in either encoding mode or decoding mode. Thus it is illegal to combine the `--ur` option with the `--in ur` input method. ``` -$ seedtool --ur --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro +$ seedtool --ur --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro seedtool: The --ur option may not be combined with the --in ur input method. ``` The following example pipes the output of one invocation of seedtool to another, first decoding a binary seed UR to hex, and then re-encoding that hex seed as BIP39. ``` -$ seedtool --in ur ur:crypto-seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro | seedtool --out bip39 --ur +$ seedtool --in ur ur:seed/oyadgdiywlamaejszswdwytltifeenftlnmnwkbdhnssro | seedtool --out bip39 --ur ur:crypto-bip39/oyadlkiyiajpjlkpiaisiejzjljtioiojyjlidhsiaiajlieiajljpjtiejzjlhsjtiykohsjzjzihkkiejzinjnidiyjnjljnihjtjyiyktinjtjyihjpiektisinjoioiskpjtiejpihieiyjkinjzkoihjpteaycyem # @@ -796,7 +796,7 @@ The UR format is designed to be efficiently transmitted in QR codes, because it ``` $ seedtool --ur | tr '[:lower:]' '[:upper:]' -UR:CRYPTO-SEED/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY +UR:seed/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY ``` ``` @@ -812,7 +812,7 @@ UR:CRYPTO-SEED/OYADGDFMOTZEWPCAHHFYUTREKPEYGHGSGAKESKJYHPWYEY # $ seedtool --ur | tr '[:lower:]' '[:upper:]' | tee /dev/tty | tr -d '\n' | qrencode -o seedqrcode.png -l L -UR:CRYPTO-SEED/OYADGDCPCNKOCSNNQDCKUEGABKMUZMYNSGGUBDRYTYVTSN +UR:SEED/OYADGDCPCNKOCSNNQDCKUEGABKMUZMYNSGGUBDRYTYVTSN ``` `seedqrcode.png`: @@ -840,22 +840,22 @@ When a UR encoding must be broken up into parts, seedtool prints each part on a ``` $ seedtool --count 400 --ur=100 -ur:crypto-seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd -ur:crypto-seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih -ur:crypto-seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm -ur:crypto-seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs -ur:crypto-seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm +ur:seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd +ur:seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih +ur:seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm +ur:seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs +ur:seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm ``` The original seed can be recovered from the above: ``` $ seedtool --in ur -ur:crypto-seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd -ur:crypto-seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih -ur:crypto-seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm -ur:crypto-seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs -ur:crypto-seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm +ur:seed/1-5/lpadahcfadmdcyindaseahhdgyoyadhkadmhynhliyctvsmdyawdwmjoyljllgmofnnygdfmpddnimkgmkhgrsvozctbdaaactchdnoegscseehfndsepllfcslnathlktiydpdebzrffsmyidmywftstlzefttsdipagugtqdktleiynbamvovohersaeryvewd +ur:seed/2-5/lpaoahcfadmdcyindaseahhdgyssdtbbksjkjkjzmopsssmyhkhguroepylpnbcxonztlbhgehcmhgjeyloxechdskrovdyntlyafgzopfahsffmkogsgmnnjtzsiehhttswjyktfgaennhedpkocejeolpmlbiohfeotypmyajllsfdcxwkvlrndegmmweeaxih +ur:seed/3-5/lpaxahcfadmdcyindaseahhdgyiolgktieghksfsmwwppmutghgwolmyoxsoylqzpypylehdfphfecbgtlnyzmgdcpsnmejputdnaeguaodnwyfensbacymwtdgewnbtbnlozerobnzcvawndizegwftwnrlehregenbrlhkahadnbskjznshhkkbasrhltoptdm +ur:seed/4-5/lpaaahcfadmdcyindaseahhdgyylbgheprcpecmhghfnrsghlfbwidjepkiytaptpdoesrfwfylstpfrgwrffxwydizeoniybkmkflemledemnahnymerpjkktwnrtpsgltydwdyrlsobbldkklghlbncwzsryflmekpvednesbektlgbeyntyostngdwzhdcnbs +ur:seed/5-5/lpahahcfadmdcyindaseahhdgytncfguweptroasfdwdtbsofwdyaejzutjshlhkfhutynkbglwnwtgsvanyclurveehosfptbrpfertwpetdkwegmsamtbebyjesrlbhgrystjnmwmniynywnjobawsstcevahnecnsaadylfwdlyaerddaatdajnbwjeidldcm ^D f65d661fe895f8eaeb70f76f8d923c9a503ea82b6a7b9857bfe2fdd625041f172ba24c1834569bc1ae821886075d77662d2815bc3d8f628ff3d7d5fe3ad727b1534db3778a66a006e2e25fbfc429147873736c92acc48f5957dfa2ab85a020a5fc7f573116576bf7a43558c5b8e7f6d5f846fbb005cc3e764c529e6efa645cd1c6747746009e5f2d761c6ba6ad7f675633d4adf86f834820f4e3be2852678d776454783d94ecaddd544fa68fa4c9f7b4abab8a5841563512d59aff5022cd9172dd2b0053022bee459c0e1a94d24af10d0c88feb80cfde6f127fe4f3af1b731b54aa0b7590501a0c56c9c5c790ec3f7125fb2223590543cbf548213626baa66d9a9a8a2c3424483d83b4fbc43ee27fea5660a9847378a288e059a91b67377f1c0ac4ed42c30b7c91489798d5d0c1bfabd479175e42b3910778d10f6d4a7da50da1953eda9b80948ead6c94230006cdd715d593fddf67e4ef1f04ce69a21dfe431a741d6b645c0ec3824ed52c29610116bc37f57bdc76d948e669af1700eefc71ce660359c043082ea8100ba2507256d13 ``` @@ -870,51 +870,51 @@ When encoding a multi-part UR, seedtool outputs the minimum number of parts need # $ seedtool --count 300 --deterministic TEST --ur=50 -ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr -ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn -ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest -ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt -ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki -ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn -ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl +ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr +ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn +ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest +ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt +ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki +ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn +ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl # # Generate the same multi-part UR, but add 10 additional parts # $ seedtool --deterministic TEST --count 300 --ur=50 --parts 10 -ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr -ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn -ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest -ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt -ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki -ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn -ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl -ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp -ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk -ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl -ur:crypto-seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti -ur:crypto-seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg -ur:crypto-seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk -ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk -ur:crypto-seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb -ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd -ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe +ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr +ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn +ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest +ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt +ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki +ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn +ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl +ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp +ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk +ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl +ur:seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti +ur:seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg +ur:seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk +ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk +ur:seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb +ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd +ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe # # Reconstruct the message from a subset of the generated parts. # $ seedtool --in ur -ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn -ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt -ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki -ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl -ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp -ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk -ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl -ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk -ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd -ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe +ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn +ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt +ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki +ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl +ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp +ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk +ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl +ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk +ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd +ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe ^D 9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af ``` @@ -950,11 +950,11 @@ ur:crypto-sskr/taadecgoretkaeadaoeeoystlowdrlutylgllaampyfwswwppsaocfbtns ### 0.10.0, 12/15/2020 -* Now parses (and ignores) the `name` and `note` fields of a `ur:crypto-seed` given as input. +* Now parses (and ignores) the `name` and `note` fields of a `ur:seed` given as input. ### 0.9.1, 10/13/2020 -* Removed `birthdate` field from generated `ur:crypto-seed` URs, which was causing unit tests to become invalid. A specific flag to set the `birthdate` field could be added at a later date. +* Removed `birthdate` field from generated `ur:seed` URs, which was causing unit tests to become invalid. A specific flag to set the `birthdate` field could be added at a later date. ### 0.9.0, 10/4/2020 diff --git a/Docs/Usage.md b/Docs/Usage.md index 97341d5..a37336e 100644 --- a/Docs/Usage.md +++ b/Docs/Usage.md @@ -83,7 +83,7 @@ tuna acid epic gyro many meow able acid also girl void oval fish exam veto gala ``` $ seedtool --ur | tr [:lower:] [:upper:] | tee /dev/tty | qrencode -o seedqrcode.png -l L -UR:CRYPTO-SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK +UR:SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK ``` ![](../manual-images/seedqrcode.png) @@ -92,37 +92,36 @@ UR:CRYPTO-SEED/OEADGDJOCNNEESSPDECECMVLFMLUOSBTDWQZFEAOTPIECFFDJZPYTAIEKK ``` $ seedtool --deterministic=TEST --count 64 --ur=20 -ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh -ur:crypto-seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg -ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw -ur:crypto-seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln +ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh +ur:seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg +ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw +ur:seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln ``` ### Same as above, but generate 5 additional parts using fountain codes ``` $ seedtool --deterministic=TEST --count 64 --ur=20 --parts 5 -ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh -ur:crypto-seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg -ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw -ur:crypto-seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln -ur:crypto-seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst -ur:crypto-seed/6-4/lpamaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywylofxjerl -ur:crypto-seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt -ur:crypto-seed/8-4/lpayaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsykpamtlp -ur:crypto-seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss +ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh +ur:seed/2-4/lpaoaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybswddnkolg +ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw +ur:seed/4-4/lpaaaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshyqzwfssln +ur:seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst +ur:seed/6-4/lpamaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywylofxjerl +ur:seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt +ur:seed/8-4/lpayaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsykpamtlp +ur:seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss ``` ### Recover the seed from UR using a subset of the generated parts ``` $ seedtool --in ur -ur:crypto-seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh -ur:crypto-seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw -ur:crypto-seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst -ur:crypto-seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt -ur:crypto-seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss +ur:seed/1-4/lpadaacsfycyutrpgrfggyoyadhdfznteelblrcygldwvarflojtcywyhtmtdpeh +ur:seed/3-4/lpaxaacsfycyutrpgrfggyjkspvseesawmrltdlnlgkplfbkqzzoglfejtgylpfw +ur:seed/5-4/lpahaacsfycyutrpgrfggyoyaegsnedtrowsdpgtimmwzspfqdjkhshytnlburst +ur:seed/7-4/lpataacsfycyutrpgrfggytdsopfjyheursphfnssrhkierpfnmdghpywnylisbt +ur:seed/9-4/lpasaacsfycyutrpgrfggyjytpdkfwprylienshnjnpluypmamtkmybsndfslgss ^D 9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e ``` - diff --git a/build-aux/config.guess b/build-aux/config.guess new file mode 100755 index 0000000..1972fda --- /dev/null +++ b/build-aux/config.guess @@ -0,0 +1,1700 @@ +#! /bin/sh +# Attempt to guess a canonical system name. +# Copyright 1992-2021 Free Software Foundation, Inc. + +timestamp='2021-01-25' + +# This file is free software; you can redistribute it and/or modify it +# under the terms of the GNU General Public License as published by +# the Free Software Foundation; either version 3 of the License, or +# (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, but +# WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, see . +# +# As a special exception to the GNU General Public License, if you +# distribute this file as part of a program that contains a +# configuration script generated by Autoconf, you may include it under +# the same distribution terms that you use for the rest of that +# program. This Exception is an additional permission under section 7 +# of the GNU General Public License, version 3 ("GPLv3"). +# +# Originally written by Per Bothner; maintained since 2000 by Ben Elliston. +# +# You can get the latest version of this script from: +# https://git.savannah.gnu.org/cgit/config.git/plain/config.guess +# +# Please send patches to . + + +me=$(echo "$0" | sed -e 's,.*/,,') + +usage="\ +Usage: $0 [OPTION] + +Output the configuration name of the system \`$me' is run on. + +Options: + -h, --help print this help, then exit + -t, --time-stamp print date of last modification, then exit + -v, --version print version number, then exit + +Report bugs and patches to ." + +version="\ +GNU config.guess ($timestamp) + +Originally written by Per Bothner. +Copyright 1992-2021 Free Software Foundation, Inc. + +This is free software; see the source for copying conditions. There is NO +warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." + +help=" +Try \`$me --help' for more information." + +# Parse command line +while test $# -gt 0 ; do + case $1 in + --time-stamp | --time* | -t ) + echo "$timestamp" ; exit ;; + --version | -v ) + echo "$version" ; exit ;; + --help | --h* | -h ) + echo "$usage"; exit ;; + -- ) # Stop option processing + shift; break ;; + - ) # Use stdin as input. + break ;; + -* ) + echo "$me: invalid option $1$help" >&2 + exit 1 ;; + * ) + break ;; + esac +done + +if test $# != 0; then + echo "$me: too many arguments$help" >&2 + exit 1 +fi + +# CC_FOR_BUILD -- compiler used by this script. Note that the use of a +# compiler to aid in system detection is discouraged as it requires +# temporary files to be created and, as you can see below, it is a +# headache to deal with in a portable fashion. + +# Historically, `CC_FOR_BUILD' used to be named `HOST_CC'. We still +# use `HOST_CC' if defined, but it is deprecated. + +# Portable tmp directory creation inspired by the Autoconf team. + +tmp= +# shellcheck disable=SC2172 +trap 'test -z "$tmp" || rm -fr "$tmp"' 0 1 2 13 15 + +set_cc_for_build() { + # prevent multiple calls if $tmp is already set + test "$tmp" && return 0 + : "${TMPDIR=/tmp}" + # shellcheck disable=SC2039 + { tmp=$( (umask 077 && mktemp -d "$TMPDIR/cgXXXXXX") 2>/dev/null) && test -n "$tmp" && test -d "$tmp" ; } || + { test -n "$RANDOM" && tmp=$TMPDIR/cg$$-$RANDOM && (umask 077 && mkdir "$tmp" 2>/dev/null) ; } || + { tmp=$TMPDIR/cg-$$ && (umask 077 && mkdir "$tmp" 2>/dev/null) && echo "Warning: creating insecure temp directory" >&2 ; } || + { echo "$me: cannot create a temporary directory in $TMPDIR" >&2 ; exit 1 ; } + dummy=$tmp/dummy + case ${CC_FOR_BUILD-},${HOST_CC-},${CC-} in + ,,) echo "int x;" > "$dummy.c" + for driver in cc gcc c89 c99 ; do + if ($driver -c -o "$dummy.o" "$dummy.c") >/dev/null 2>&1 ; then + CC_FOR_BUILD="$driver" + break + fi + done + if test x"$CC_FOR_BUILD" = x ; then + CC_FOR_BUILD=no_compiler_found + fi + ;; + ,,*) CC_FOR_BUILD=$CC ;; + ,*,*) CC_FOR_BUILD=$HOST_CC ;; + esac +} + +# This is needed to find uname on a Pyramid OSx when run in the BSD universe. +# (ghazi@noc.rutgers.edu 1994-08-24) +if test -f /.attbin/uname ; then + PATH=$PATH:/.attbin ; export PATH +fi + +UNAME_MACHINE=$( (uname -m) 2>/dev/null) || UNAME_MACHINE=unknown +UNAME_RELEASE=$( (uname -r) 2>/dev/null) || UNAME_RELEASE=unknown +UNAME_SYSTEM=$( (uname -s) 2>/dev/null) || UNAME_SYSTEM=unknown +UNAME_VERSION=$( (uname -v) 2>/dev/null) || UNAME_VERSION=unknown + +case "$UNAME_SYSTEM" in +Linux|GNU|GNU/*) + LIBC=unknown + + set_cc_for_build + cat <<-EOF > "$dummy.c" + #include + #if defined(__UCLIBC__) + LIBC=uclibc + #elif defined(__dietlibc__) + LIBC=dietlibc + #elif defined(__GLIBC__) + LIBC=gnu + #else + #include + /* First heuristic to detect musl libc. */ + #ifdef __DEFINED_va_list + LIBC=musl + #endif + #endif + EOF + eval "$($CC_FOR_BUILD -E "$dummy.c" 2>/dev/null | grep '^LIBC' | sed 's, ,,g')" + + # Second heuristic to detect musl libc. + if [ "$LIBC" = unknown ] && + command -v ldd >/dev/null && + ldd --version 2>&1 | grep -q ^musl; then + LIBC=musl + fi + + # If the system lacks a compiler, then just pick glibc. + # We could probably try harder. + if [ "$LIBC" = unknown ]; then + LIBC=gnu + fi + ;; +esac + +# Note: order is significant - the case branches are not exclusive. + +case "$UNAME_MACHINE:$UNAME_SYSTEM:$UNAME_RELEASE:$UNAME_VERSION" in + *:NetBSD:*:*) + # NetBSD (nbsd) targets should (where applicable) match one or + # more of the tuples: *-*-netbsdelf*, *-*-netbsdaout*, + # *-*-netbsdecoff* and *-*-netbsd*. For targets that recently + # switched to ELF, *-*-netbsd* would select the old + # object file format. This provides both forward + # compatibility and a consistent mechanism for selecting the + # object file format. + # + # Note: NetBSD doesn't particularly care about the vendor + # portion of the name. We always set it to "unknown". + UNAME_MACHINE_ARCH=$( (uname -p 2>/dev/null || \ + /sbin/sysctl -n hw.machine_arch 2>/dev/null || \ + /usr/sbin/sysctl -n hw.machine_arch 2>/dev/null || \ + echo unknown)) + case "$UNAME_MACHINE_ARCH" in + aarch64eb) machine=aarch64_be-unknown ;; + armeb) machine=armeb-unknown ;; + arm*) machine=arm-unknown ;; + sh3el) machine=shl-unknown ;; + sh3eb) machine=sh-unknown ;; + sh5el) machine=sh5le-unknown ;; + earmv*) + arch=$(echo "$UNAME_MACHINE_ARCH" | sed -e 's,^e\(armv[0-9]\).*$,\1,') + endian=$(echo "$UNAME_MACHINE_ARCH" | sed -ne 's,^.*\(eb\)$,\1,p') + machine="${arch}${endian}"-unknown + ;; + *) machine="$UNAME_MACHINE_ARCH"-unknown ;; + esac + # The Operating System including object format, if it has switched + # to ELF recently (or will in the future) and ABI. + case "$UNAME_MACHINE_ARCH" in + earm*) + os=netbsdelf + ;; + arm*|i386|m68k|ns32k|sh3*|sparc|vax) + set_cc_for_build + if echo __ELF__ | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ELF__ + then + # Once all utilities can be ECOFF (netbsdecoff) or a.out (netbsdaout). + # Return netbsd for either. FIX? + os=netbsd + else + os=netbsdelf + fi + ;; + *) + os=netbsd + ;; + esac + # Determine ABI tags. + case "$UNAME_MACHINE_ARCH" in + earm*) + expr='s/^earmv[0-9]/-eabi/;s/eb$//' + abi=$(echo "$UNAME_MACHINE_ARCH" | sed -e "$expr") + ;; + esac + # The OS release + # Debian GNU/NetBSD machines have a different userland, and + # thus, need a distinct triplet. However, they do not need + # kernel version information, so it can be replaced with a + # suitable tag, in the style of linux-gnu. + case "$UNAME_VERSION" in + Debian*) + release='-gnu' + ;; + *) + release=$(echo "$UNAME_RELEASE" | sed -e 's/[-_].*//' | cut -d. -f1,2) + ;; + esac + # Since CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM: + # contains redundant information, the shorter form: + # CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM is used. + echo "$machine-${os}${release}${abi-}" + exit ;; + *:Bitrig:*:*) + UNAME_MACHINE_ARCH=$(arch | sed 's/Bitrig.//') + echo "$UNAME_MACHINE_ARCH"-unknown-bitrig"$UNAME_RELEASE" + exit ;; + *:OpenBSD:*:*) + UNAME_MACHINE_ARCH=$(arch | sed 's/OpenBSD.//') + echo "$UNAME_MACHINE_ARCH"-unknown-openbsd"$UNAME_RELEASE" + exit ;; + *:LibertyBSD:*:*) + UNAME_MACHINE_ARCH=$(arch | sed 's/^.*BSD\.//') + echo "$UNAME_MACHINE_ARCH"-unknown-libertybsd"$UNAME_RELEASE" + exit ;; + *:MidnightBSD:*:*) + echo "$UNAME_MACHINE"-unknown-midnightbsd"$UNAME_RELEASE" + exit ;; + *:ekkoBSD:*:*) + echo "$UNAME_MACHINE"-unknown-ekkobsd"$UNAME_RELEASE" + exit ;; + *:SolidBSD:*:*) + echo "$UNAME_MACHINE"-unknown-solidbsd"$UNAME_RELEASE" + exit ;; + *:OS108:*:*) + echo "$UNAME_MACHINE"-unknown-os108_"$UNAME_RELEASE" + exit ;; + macppc:MirBSD:*:*) + echo powerpc-unknown-mirbsd"$UNAME_RELEASE" + exit ;; + *:MirBSD:*:*) + echo "$UNAME_MACHINE"-unknown-mirbsd"$UNAME_RELEASE" + exit ;; + *:Sortix:*:*) + echo "$UNAME_MACHINE"-unknown-sortix + exit ;; + *:Twizzler:*:*) + echo "$UNAME_MACHINE"-unknown-twizzler + exit ;; + *:Redox:*:*) + echo "$UNAME_MACHINE"-unknown-redox + exit ;; + mips:OSF1:*.*) + echo mips-dec-osf1 + exit ;; + alpha:OSF1:*:*) + case $UNAME_RELEASE in + *4.0) + UNAME_RELEASE=$(/usr/sbin/sizer -v | awk '{print $3}') + ;; + *5.*) + UNAME_RELEASE=$(/usr/sbin/sizer -v | awk '{print $4}') + ;; + esac + # According to Compaq, /usr/sbin/psrinfo has been available on + # OSF/1 and Tru64 systems produced since 1995. I hope that + # covers most systems running today. This code pipes the CPU + # types through head -n 1, so we only detect the type of CPU 0. + ALPHA_CPU_TYPE=$(/usr/sbin/psrinfo -v | sed -n -e 's/^ The alpha \(.*\) processor.*$/\1/p' | head -n 1) + case "$ALPHA_CPU_TYPE" in + "EV4 (21064)") + UNAME_MACHINE=alpha ;; + "EV4.5 (21064)") + UNAME_MACHINE=alpha ;; + "LCA4 (21066/21068)") + UNAME_MACHINE=alpha ;; + "EV5 (21164)") + UNAME_MACHINE=alphaev5 ;; + "EV5.6 (21164A)") + UNAME_MACHINE=alphaev56 ;; + "EV5.6 (21164PC)") + UNAME_MACHINE=alphapca56 ;; + "EV5.7 (21164PC)") + UNAME_MACHINE=alphapca57 ;; + "EV6 (21264)") + UNAME_MACHINE=alphaev6 ;; + "EV6.7 (21264A)") + UNAME_MACHINE=alphaev67 ;; + "EV6.8CB (21264C)") + UNAME_MACHINE=alphaev68 ;; + "EV6.8AL (21264B)") + UNAME_MACHINE=alphaev68 ;; + "EV6.8CX (21264D)") + UNAME_MACHINE=alphaev68 ;; + "EV6.9A (21264/EV69A)") + UNAME_MACHINE=alphaev69 ;; + "EV7 (21364)") + UNAME_MACHINE=alphaev7 ;; + "EV7.9 (21364A)") + UNAME_MACHINE=alphaev79 ;; + esac + # A Pn.n version is a patched version. + # A Vn.n version is a released version. + # A Tn.n version is a released field test version. + # A Xn.n version is an unreleased experimental baselevel. + # 1.2 uses "1.2" for uname -r. + echo "$UNAME_MACHINE"-dec-osf"$(echo "$UNAME_RELEASE" | sed -e 's/^[PVTX]//' | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz)" + # Reset EXIT trap before exiting to avoid spurious non-zero exit code. + exitcode=$? + trap '' 0 + exit $exitcode ;; + Amiga*:UNIX_System_V:4.0:*) + echo m68k-unknown-sysv4 + exit ;; + *:[Aa]miga[Oo][Ss]:*:*) + echo "$UNAME_MACHINE"-unknown-amigaos + exit ;; + *:[Mm]orph[Oo][Ss]:*:*) + echo "$UNAME_MACHINE"-unknown-morphos + exit ;; + *:OS/390:*:*) + echo i370-ibm-openedition + exit ;; + *:z/VM:*:*) + echo s390-ibm-zvmoe + exit ;; + *:OS400:*:*) + echo powerpc-ibm-os400 + exit ;; + arm:RISC*:1.[012]*:*|arm:riscix:1.[012]*:*) + echo arm-acorn-riscix"$UNAME_RELEASE" + exit ;; + arm*:riscos:*:*|arm*:RISCOS:*:*) + echo arm-unknown-riscos + exit ;; + SR2?01:HI-UX/MPP:*:* | SR8000:HI-UX/MPP:*:*) + echo hppa1.1-hitachi-hiuxmpp + exit ;; + Pyramid*:OSx*:*:* | MIS*:OSx*:*:* | MIS*:SMP_DC-OSx*:*:*) + # akee@wpdis03.wpafb.af.mil (Earle F. Ake) contributed MIS and NILE. + if test "$( (/bin/universe) 2>/dev/null)" = att ; then + echo pyramid-pyramid-sysv3 + else + echo pyramid-pyramid-bsd + fi + exit ;; + NILE*:*:*:dcosx) + echo pyramid-pyramid-svr4 + exit ;; + DRS?6000:unix:4.0:6*) + echo sparc-icl-nx6 + exit ;; + DRS?6000:UNIX_SV:4.2*:7* | DRS?6000:isis:4.2*:7*) + case $(/usr/bin/uname -p) in + sparc) echo sparc-icl-nx7; exit ;; + esac ;; + s390x:SunOS:*:*) + echo "$UNAME_MACHINE"-ibm-solaris2"$(echo "$UNAME_RELEASE" | sed -e 's/[^.]*//')" + exit ;; + sun4H:SunOS:5.*:*) + echo sparc-hal-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')" + exit ;; + sun4*:SunOS:5.*:* | tadpole*:SunOS:5.*:*) + echo sparc-sun-solaris2"$(echo "$UNAME_RELEASE" | sed -e 's/[^.]*//')" + exit ;; + i86pc:AuroraUX:5.*:* | i86xen:AuroraUX:5.*:*) + echo i386-pc-auroraux"$UNAME_RELEASE" + exit ;; + i86pc:SunOS:5.*:* | i86xen:SunOS:5.*:*) + set_cc_for_build + SUN_ARCH=i386 + # If there is a compiler, see if it is configured for 64-bit objects. + # Note that the Sun cc does not turn __LP64__ into 1 like gcc does. + # This test works for both compilers. + if test "$CC_FOR_BUILD" != no_compiler_found; then + if (echo '#ifdef __amd64'; echo IS_64BIT_ARCH; echo '#endif') | \ + (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \ + grep IS_64BIT_ARCH >/dev/null + then + SUN_ARCH=x86_64 + fi + fi + echo "$SUN_ARCH"-pc-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')" + exit ;; + sun4*:SunOS:6*:*) + # According to config.sub, this is the proper way to canonicalize + # SunOS6. Hard to guess exactly what SunOS6 will be like, but + # it's likely to be more like Solaris than SunOS4. + echo sparc-sun-solaris3"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')" + exit ;; + sun4*:SunOS:*:*) + case "$(/usr/bin/arch -k)" in + Series*|S4*) + UNAME_RELEASE=$(uname -v) + ;; + esac + # Japanese Language versions have a version number like `4.1.3-JL'. + echo sparc-sun-sunos"$(echo "$UNAME_RELEASE"|sed -e 's/-/_/')" + exit ;; + sun3*:SunOS:*:*) + echo m68k-sun-sunos"$UNAME_RELEASE" + exit ;; + sun*:*:4.2BSD:*) + UNAME_RELEASE=$( (sed 1q /etc/motd | awk '{print substr($5,1,3)}') 2>/dev/null) + test "x$UNAME_RELEASE" = x && UNAME_RELEASE=3 + case "$(/bin/arch)" in + sun3) + echo m68k-sun-sunos"$UNAME_RELEASE" + ;; + sun4) + echo sparc-sun-sunos"$UNAME_RELEASE" + ;; + esac + exit ;; + aushp:SunOS:*:*) + echo sparc-auspex-sunos"$UNAME_RELEASE" + exit ;; + # The situation for MiNT is a little confusing. The machine name + # can be virtually everything (everything which is not + # "atarist" or "atariste" at least should have a processor + # > m68000). The system name ranges from "MiNT" over "FreeMiNT" + # to the lowercase version "mint" (or "freemint"). Finally + # the system name "TOS" denotes a system which is actually not + # MiNT. But MiNT is downward compatible to TOS, so this should + # be no problem. + atarist[e]:*MiNT:*:* | atarist[e]:*mint:*:* | atarist[e]:*TOS:*:*) + echo m68k-atari-mint"$UNAME_RELEASE" + exit ;; + atari*:*MiNT:*:* | atari*:*mint:*:* | atarist[e]:*TOS:*:*) + echo m68k-atari-mint"$UNAME_RELEASE" + exit ;; + *falcon*:*MiNT:*:* | *falcon*:*mint:*:* | *falcon*:*TOS:*:*) + echo m68k-atari-mint"$UNAME_RELEASE" + exit ;; + milan*:*MiNT:*:* | milan*:*mint:*:* | *milan*:*TOS:*:*) + echo m68k-milan-mint"$UNAME_RELEASE" + exit ;; + hades*:*MiNT:*:* | hades*:*mint:*:* | *hades*:*TOS:*:*) + echo m68k-hades-mint"$UNAME_RELEASE" + exit ;; + *:*MiNT:*:* | *:*mint:*:* | *:*TOS:*:*) + echo m68k-unknown-mint"$UNAME_RELEASE" + exit ;; + m68k:machten:*:*) + echo m68k-apple-machten"$UNAME_RELEASE" + exit ;; + powerpc:machten:*:*) + echo powerpc-apple-machten"$UNAME_RELEASE" + exit ;; + RISC*:Mach:*:*) + echo mips-dec-mach_bsd4.3 + exit ;; + RISC*:ULTRIX:*:*) + echo mips-dec-ultrix"$UNAME_RELEASE" + exit ;; + VAX*:ULTRIX*:*:*) + echo vax-dec-ultrix"$UNAME_RELEASE" + exit ;; + 2020:CLIX:*:* | 2430:CLIX:*:*) + echo clipper-intergraph-clix"$UNAME_RELEASE" + exit ;; + mips:*:*:UMIPS | mips:*:*:RISCos) + set_cc_for_build + sed 's/^ //' << EOF > "$dummy.c" +#ifdef __cplusplus +#include /* for printf() prototype */ + int main (int argc, char *argv[]) { +#else + int main (argc, argv) int argc; char *argv[]; { +#endif + #if defined (host_mips) && defined (MIPSEB) + #if defined (SYSTYPE_SYSV) + printf ("mips-mips-riscos%ssysv\\n", argv[1]); exit (0); + #endif + #if defined (SYSTYPE_SVR4) + printf ("mips-mips-riscos%ssvr4\\n", argv[1]); exit (0); + #endif + #if defined (SYSTYPE_BSD43) || defined(SYSTYPE_BSD) + printf ("mips-mips-riscos%sbsd\\n", argv[1]); exit (0); + #endif + #endif + exit (-1); + } +EOF + $CC_FOR_BUILD -o "$dummy" "$dummy.c" && + dummyarg=$(echo "$UNAME_RELEASE" | sed -n 's/\([0-9]*\).*/\1/p') && + SYSTEM_NAME=$("$dummy" "$dummyarg") && + { echo "$SYSTEM_NAME"; exit; } + echo mips-mips-riscos"$UNAME_RELEASE" + exit ;; + Motorola:PowerMAX_OS:*:*) + echo powerpc-motorola-powermax + exit ;; + Motorola:*:4.3:PL8-*) + echo powerpc-harris-powermax + exit ;; + Night_Hawk:*:*:PowerMAX_OS | Synergy:PowerMAX_OS:*:*) + echo powerpc-harris-powermax + exit ;; + Night_Hawk:Power_UNIX:*:*) + echo powerpc-harris-powerunix + exit ;; + m88k:CX/UX:7*:*) + echo m88k-harris-cxux7 + exit ;; + m88k:*:4*:R4*) + echo m88k-motorola-sysv4 + exit ;; + m88k:*:3*:R3*) + echo m88k-motorola-sysv3 + exit ;; + AViiON:dgux:*:*) + # DG/UX returns AViiON for all architectures + UNAME_PROCESSOR=$(/usr/bin/uname -p) + if test "$UNAME_PROCESSOR" = mc88100 || test "$UNAME_PROCESSOR" = mc88110 + then + if test "$TARGET_BINARY_INTERFACE"x = m88kdguxelfx || \ + test "$TARGET_BINARY_INTERFACE"x = x + then + echo m88k-dg-dgux"$UNAME_RELEASE" + else + echo m88k-dg-dguxbcs"$UNAME_RELEASE" + fi + else + echo i586-dg-dgux"$UNAME_RELEASE" + fi + exit ;; + M88*:DolphinOS:*:*) # DolphinOS (SVR3) + echo m88k-dolphin-sysv3 + exit ;; + M88*:*:R3*:*) + # Delta 88k system running SVR3 + echo m88k-motorola-sysv3 + exit ;; + XD88*:*:*:*) # Tektronix XD88 system running UTekV (SVR3) + echo m88k-tektronix-sysv3 + exit ;; + Tek43[0-9][0-9]:UTek:*:*) # Tektronix 4300 system running UTek (BSD) + echo m68k-tektronix-bsd + exit ;; + *:IRIX*:*:*) + echo mips-sgi-irix"$(echo "$UNAME_RELEASE"|sed -e 's/-/_/g')" + exit ;; + ????????:AIX?:[12].1:2) # AIX 2.2.1 or AIX 2.1.1 is RT/PC AIX. + echo romp-ibm-aix # uname -m gives an 8 hex-code CPU id + exit ;; # Note that: echo "'$(uname -s)'" gives 'AIX ' + i*86:AIX:*:*) + echo i386-ibm-aix + exit ;; + ia64:AIX:*:*) + if test -x /usr/bin/oslevel ; then + IBM_REV=$(/usr/bin/oslevel) + else + IBM_REV="$UNAME_VERSION.$UNAME_RELEASE" + fi + echo "$UNAME_MACHINE"-ibm-aix"$IBM_REV" + exit ;; + *:AIX:2:3) + if grep bos325 /usr/include/stdio.h >/dev/null 2>&1; then + set_cc_for_build + sed 's/^ //' << EOF > "$dummy.c" + #include + + main() + { + if (!__power_pc()) + exit(1); + puts("powerpc-ibm-aix3.2.5"); + exit(0); + } +EOF + if $CC_FOR_BUILD -o "$dummy" "$dummy.c" && SYSTEM_NAME=$("$dummy") + then + echo "$SYSTEM_NAME" + else + echo rs6000-ibm-aix3.2.5 + fi + elif grep bos324 /usr/include/stdio.h >/dev/null 2>&1; then + echo rs6000-ibm-aix3.2.4 + else + echo rs6000-ibm-aix3.2 + fi + exit ;; + *:AIX:*:[4567]) + IBM_CPU_ID=$(/usr/sbin/lsdev -C -c processor -S available | sed 1q | awk '{ print $1 }') + if /usr/sbin/lsattr -El "$IBM_CPU_ID" | grep ' POWER' >/dev/null 2>&1; then + IBM_ARCH=rs6000 + else + IBM_ARCH=powerpc + fi + if test -x /usr/bin/lslpp ; then + IBM_REV=$(/usr/bin/lslpp -Lqc bos.rte.libc | + awk -F: '{ print $3 }' | sed s/[0-9]*$/0/) + else + IBM_REV="$UNAME_VERSION.$UNAME_RELEASE" + fi + echo "$IBM_ARCH"-ibm-aix"$IBM_REV" + exit ;; + *:AIX:*:*) + echo rs6000-ibm-aix + exit ;; + ibmrt:4.4BSD:*|romp-ibm:4.4BSD:*) + echo romp-ibm-bsd4.4 + exit ;; + ibmrt:*BSD:*|romp-ibm:BSD:*) # covers RT/PC BSD and + echo romp-ibm-bsd"$UNAME_RELEASE" # 4.3 with uname added to + exit ;; # report: romp-ibm BSD 4.3 + *:BOSX:*:*) + echo rs6000-bull-bosx + exit ;; + DPX/2?00:B.O.S.:*:*) + echo m68k-bull-sysv3 + exit ;; + 9000/[34]??:4.3bsd:1.*:*) + echo m68k-hp-bsd + exit ;; + hp300:4.4BSD:*:* | 9000/[34]??:4.3bsd:2.*:*) + echo m68k-hp-bsd4.4 + exit ;; + 9000/[34678]??:HP-UX:*:*) + HPUX_REV=$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*.[0B]*//') + case "$UNAME_MACHINE" in + 9000/31?) HP_ARCH=m68000 ;; + 9000/[34]??) HP_ARCH=m68k ;; + 9000/[678][0-9][0-9]) + if test -x /usr/bin/getconf; then + sc_cpu_version=$(/usr/bin/getconf SC_CPU_VERSION 2>/dev/null) + sc_kernel_bits=$(/usr/bin/getconf SC_KERNEL_BITS 2>/dev/null) + case "$sc_cpu_version" in + 523) HP_ARCH=hppa1.0 ;; # CPU_PA_RISC1_0 + 528) HP_ARCH=hppa1.1 ;; # CPU_PA_RISC1_1 + 532) # CPU_PA_RISC2_0 + case "$sc_kernel_bits" in + 32) HP_ARCH=hppa2.0n ;; + 64) HP_ARCH=hppa2.0w ;; + '') HP_ARCH=hppa2.0 ;; # HP-UX 10.20 + esac ;; + esac + fi + if test "$HP_ARCH" = ""; then + set_cc_for_build + sed 's/^ //' << EOF > "$dummy.c" + + #define _HPUX_SOURCE + #include + #include + + int main () + { + #if defined(_SC_KERNEL_BITS) + long bits = sysconf(_SC_KERNEL_BITS); + #endif + long cpu = sysconf (_SC_CPU_VERSION); + + switch (cpu) + { + case CPU_PA_RISC1_0: puts ("hppa1.0"); break; + case CPU_PA_RISC1_1: puts ("hppa1.1"); break; + case CPU_PA_RISC2_0: + #if defined(_SC_KERNEL_BITS) + switch (bits) + { + case 64: puts ("hppa2.0w"); break; + case 32: puts ("hppa2.0n"); break; + default: puts ("hppa2.0"); break; + } break; + #else /* !defined(_SC_KERNEL_BITS) */ + puts ("hppa2.0"); break; + #endif + default: puts ("hppa1.0"); break; + } + exit (0); + } +EOF + (CCOPTS="" $CC_FOR_BUILD -o "$dummy" "$dummy.c" 2>/dev/null) && HP_ARCH=$("$dummy") + test -z "$HP_ARCH" && HP_ARCH=hppa + fi ;; + esac + if test "$HP_ARCH" = hppa2.0w + then + set_cc_for_build + + # hppa2.0w-hp-hpux* has a 64-bit kernel and a compiler generating + # 32-bit code. hppa64-hp-hpux* has the same kernel and a compiler + # generating 64-bit code. GNU and HP use different nomenclature: + # + # $ CC_FOR_BUILD=cc ./config.guess + # => hppa2.0w-hp-hpux11.23 + # $ CC_FOR_BUILD="cc +DA2.0w" ./config.guess + # => hppa64-hp-hpux11.23 + + if echo __LP64__ | (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | + grep -q __LP64__ + then + HP_ARCH=hppa2.0w + else + HP_ARCH=hppa64 + fi + fi + echo "$HP_ARCH"-hp-hpux"$HPUX_REV" + exit ;; + ia64:HP-UX:*:*) + HPUX_REV=$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*.[0B]*//') + echo ia64-hp-hpux"$HPUX_REV" + exit ;; + 3050*:HI-UX:*:*) + set_cc_for_build + sed 's/^ //' << EOF > "$dummy.c" + #include + int + main () + { + long cpu = sysconf (_SC_CPU_VERSION); + /* The order matters, because CPU_IS_HP_MC68K erroneously returns + true for CPU_PA_RISC1_0. CPU_IS_PA_RISC returns correct + results, however. */ + if (CPU_IS_PA_RISC (cpu)) + { + switch (cpu) + { + case CPU_PA_RISC1_0: puts ("hppa1.0-hitachi-hiuxwe2"); break; + case CPU_PA_RISC1_1: puts ("hppa1.1-hitachi-hiuxwe2"); break; + case CPU_PA_RISC2_0: puts ("hppa2.0-hitachi-hiuxwe2"); break; + default: puts ("hppa-hitachi-hiuxwe2"); break; + } + } + else if (CPU_IS_HP_MC68K (cpu)) + puts ("m68k-hitachi-hiuxwe2"); + else puts ("unknown-hitachi-hiuxwe2"); + exit (0); + } +EOF + $CC_FOR_BUILD -o "$dummy" "$dummy.c" && SYSTEM_NAME=$("$dummy") && + { echo "$SYSTEM_NAME"; exit; } + echo unknown-hitachi-hiuxwe2 + exit ;; + 9000/7??:4.3bsd:*:* | 9000/8?[79]:4.3bsd:*:*) + echo hppa1.1-hp-bsd + exit ;; + 9000/8??:4.3bsd:*:*) + echo hppa1.0-hp-bsd + exit ;; + *9??*:MPE/iX:*:* | *3000*:MPE/iX:*:*) + echo hppa1.0-hp-mpeix + exit ;; + hp7??:OSF1:*:* | hp8?[79]:OSF1:*:*) + echo hppa1.1-hp-osf + exit ;; + hp8??:OSF1:*:*) + echo hppa1.0-hp-osf + exit ;; + i*86:OSF1:*:*) + if test -x /usr/sbin/sysversion ; then + echo "$UNAME_MACHINE"-unknown-osf1mk + else + echo "$UNAME_MACHINE"-unknown-osf1 + fi + exit ;; + parisc*:Lites*:*:*) + echo hppa1.1-hp-lites + exit ;; + C1*:ConvexOS:*:* | convex:ConvexOS:C1*:*) + echo c1-convex-bsd + exit ;; + C2*:ConvexOS:*:* | convex:ConvexOS:C2*:*) + if getsysinfo -f scalar_acc + then echo c32-convex-bsd + else echo c2-convex-bsd + fi + exit ;; + C34*:ConvexOS:*:* | convex:ConvexOS:C34*:*) + echo c34-convex-bsd + exit ;; + C38*:ConvexOS:*:* | convex:ConvexOS:C38*:*) + echo c38-convex-bsd + exit ;; + C4*:ConvexOS:*:* | convex:ConvexOS:C4*:*) + echo c4-convex-bsd + exit ;; + CRAY*Y-MP:*:*:*) + echo ymp-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/' + exit ;; + CRAY*[A-Z]90:*:*:*) + echo "$UNAME_MACHINE"-cray-unicos"$UNAME_RELEASE" \ + | sed -e 's/CRAY.*\([A-Z]90\)/\1/' \ + -e y/ABCDEFGHIJKLMNOPQRSTUVWXYZ/abcdefghijklmnopqrstuvwxyz/ \ + -e 's/\.[^.]*$/.X/' + exit ;; + CRAY*TS:*:*:*) + echo t90-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/' + exit ;; + CRAY*T3E:*:*:*) + echo alphaev5-cray-unicosmk"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/' + exit ;; + CRAY*SV1:*:*:*) + echo sv1-cray-unicos"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/' + exit ;; + *:UNICOS/mp:*:*) + echo craynv-cray-unicosmp"$UNAME_RELEASE" | sed -e 's/\.[^.]*$/.X/' + exit ;; + F30[01]:UNIX_System_V:*:* | F700:UNIX_System_V:*:*) + FUJITSU_PROC=$(uname -m | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz) + FUJITSU_SYS=$(uname -p | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/\///') + FUJITSU_REL=$(echo "$UNAME_RELEASE" | sed -e 's/ /_/') + echo "${FUJITSU_PROC}-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}" + exit ;; + 5000:UNIX_System_V:4.*:*) + FUJITSU_SYS=$(uname -p | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/\///') + FUJITSU_REL=$(echo "$UNAME_RELEASE" | tr ABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyz | sed -e 's/ /_/') + echo "sparc-fujitsu-${FUJITSU_SYS}${FUJITSU_REL}" + exit ;; + i*86:BSD/386:*:* | i*86:BSD/OS:*:* | *:Ascend\ Embedded/OS:*:*) + echo "$UNAME_MACHINE"-pc-bsdi"$UNAME_RELEASE" + exit ;; + sparc*:BSD/OS:*:*) + echo sparc-unknown-bsdi"$UNAME_RELEASE" + exit ;; + *:BSD/OS:*:*) + echo "$UNAME_MACHINE"-unknown-bsdi"$UNAME_RELEASE" + exit ;; + arm:FreeBSD:*:*) + UNAME_PROCESSOR=$(uname -p) + set_cc_for_build + if echo __ARM_PCS_VFP | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ARM_PCS_VFP + then + echo "${UNAME_PROCESSOR}"-unknown-freebsd"$(echo ${UNAME_RELEASE}|sed -e 's/[-(].*//')"-gnueabi + else + echo "${UNAME_PROCESSOR}"-unknown-freebsd"$(echo ${UNAME_RELEASE}|sed -e 's/[-(].*//')"-gnueabihf + fi + exit ;; + *:FreeBSD:*:*) + UNAME_PROCESSOR=$(/usr/bin/uname -p) + case "$UNAME_PROCESSOR" in + amd64) + UNAME_PROCESSOR=x86_64 ;; + i386) + UNAME_PROCESSOR=i586 ;; + esac + echo "$UNAME_PROCESSOR"-unknown-freebsd"$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')" + exit ;; + i*:CYGWIN*:*) + echo "$UNAME_MACHINE"-pc-cygwin + exit ;; + *:MINGW64*:*) + echo "$UNAME_MACHINE"-pc-mingw64 + exit ;; + *:MINGW*:*) + echo "$UNAME_MACHINE"-pc-mingw32 + exit ;; + *:MSYS*:*) + echo "$UNAME_MACHINE"-pc-msys + exit ;; + i*:PW*:*) + echo "$UNAME_MACHINE"-pc-pw32 + exit ;; + *:Interix*:*) + case "$UNAME_MACHINE" in + x86) + echo i586-pc-interix"$UNAME_RELEASE" + exit ;; + authenticamd | genuineintel | EM64T) + echo x86_64-unknown-interix"$UNAME_RELEASE" + exit ;; + IA64) + echo ia64-unknown-interix"$UNAME_RELEASE" + exit ;; + esac ;; + i*:UWIN*:*) + echo "$UNAME_MACHINE"-pc-uwin + exit ;; + amd64:CYGWIN*:*:* | x86_64:CYGWIN*:*:*) + echo x86_64-pc-cygwin + exit ;; + prep*:SunOS:5.*:*) + echo powerpcle-unknown-solaris2"$(echo "$UNAME_RELEASE"|sed -e 's/[^.]*//')" + exit ;; + *:GNU:*:*) + # the GNU system + echo "$(echo "$UNAME_MACHINE"|sed -e 's,[-/].*$,,')-unknown-$LIBC$(echo "$UNAME_RELEASE"|sed -e 's,/.*$,,')" + exit ;; + *:GNU/*:*:*) + # other systems with GNU libc and userland + echo "$UNAME_MACHINE-unknown-$(echo "$UNAME_SYSTEM" | sed 's,^[^/]*/,,' | tr "[:upper:]" "[:lower:]")$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')-$LIBC" + exit ;; + *:Minix:*:*) + echo "$UNAME_MACHINE"-unknown-minix + exit ;; + aarch64:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + aarch64_be:Linux:*:*) + UNAME_MACHINE=aarch64_be + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + alpha:Linux:*:*) + case $(sed -n '/^cpu model/s/^.*: \(.*\)/\1/p' /proc/cpuinfo 2>/dev/null) in + EV5) UNAME_MACHINE=alphaev5 ;; + EV56) UNAME_MACHINE=alphaev56 ;; + PCA56) UNAME_MACHINE=alphapca56 ;; + PCA57) UNAME_MACHINE=alphapca56 ;; + EV6) UNAME_MACHINE=alphaev6 ;; + EV67) UNAME_MACHINE=alphaev67 ;; + EV68*) UNAME_MACHINE=alphaev68 ;; + esac + objdump --private-headers /bin/sh | grep -q ld.so.1 + if test "$?" = 0 ; then LIBC=gnulibc1 ; fi + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + arc:Linux:*:* | arceb:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + arm*:Linux:*:*) + set_cc_for_build + if echo __ARM_EABI__ | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ARM_EABI__ + then + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + else + if echo __ARM_PCS_VFP | $CC_FOR_BUILD -E - 2>/dev/null \ + | grep -q __ARM_PCS_VFP + then + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"eabi + else + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC"eabihf + fi + fi + exit ;; + avr32*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + cris:Linux:*:*) + echo "$UNAME_MACHINE"-axis-linux-"$LIBC" + exit ;; + crisv32:Linux:*:*) + echo "$UNAME_MACHINE"-axis-linux-"$LIBC" + exit ;; + e2k:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + frv:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + hexagon:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + i*86:Linux:*:*) + echo "$UNAME_MACHINE"-pc-linux-"$LIBC" + exit ;; + ia64:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + k1om:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + loongarch32:Linux:*:* | loongarch64:Linux:*:* | loongarchx32:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + m32r*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + m68*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + mips:Linux:*:* | mips64:Linux:*:*) + set_cc_for_build + IS_GLIBC=0 + test x"${LIBC}" = xgnu && IS_GLIBC=1 + sed 's/^ //' << EOF > "$dummy.c" + #undef CPU + #undef mips + #undef mipsel + #undef mips64 + #undef mips64el + #if ${IS_GLIBC} && defined(_ABI64) + LIBCABI=gnuabi64 + #else + #if ${IS_GLIBC} && defined(_ABIN32) + LIBCABI=gnuabin32 + #else + LIBCABI=${LIBC} + #endif + #endif + + #if ${IS_GLIBC} && defined(__mips64) && defined(__mips_isa_rev) && __mips_isa_rev>=6 + CPU=mipsisa64r6 + #else + #if ${IS_GLIBC} && !defined(__mips64) && defined(__mips_isa_rev) && __mips_isa_rev>=6 + CPU=mipsisa32r6 + #else + #if defined(__mips64) + CPU=mips64 + #else + CPU=mips + #endif + #endif + #endif + + #if defined(__MIPSEL__) || defined(__MIPSEL) || defined(_MIPSEL) || defined(MIPSEL) + MIPS_ENDIAN=el + #else + #if defined(__MIPSEB__) || defined(__MIPSEB) || defined(_MIPSEB) || defined(MIPSEB) + MIPS_ENDIAN= + #else + MIPS_ENDIAN= + #endif + #endif +EOF + eval "$($CC_FOR_BUILD -E "$dummy.c" 2>/dev/null | grep '^CPU\|^MIPS_ENDIAN\|^LIBCABI')" + test "x$CPU" != x && { echo "$CPU${MIPS_ENDIAN}-unknown-linux-$LIBCABI"; exit; } + ;; + mips64el:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + openrisc*:Linux:*:*) + echo or1k-unknown-linux-"$LIBC" + exit ;; + or32:Linux:*:* | or1k*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + padre:Linux:*:*) + echo sparc-unknown-linux-"$LIBC" + exit ;; + parisc64:Linux:*:* | hppa64:Linux:*:*) + echo hppa64-unknown-linux-"$LIBC" + exit ;; + parisc:Linux:*:* | hppa:Linux:*:*) + # Look for CPU level + case $(grep '^cpu[^a-z]*:' /proc/cpuinfo 2>/dev/null | cut -d' ' -f2) in + PA7*) echo hppa1.1-unknown-linux-"$LIBC" ;; + PA8*) echo hppa2.0-unknown-linux-"$LIBC" ;; + *) echo hppa-unknown-linux-"$LIBC" ;; + esac + exit ;; + ppc64:Linux:*:*) + echo powerpc64-unknown-linux-"$LIBC" + exit ;; + ppc:Linux:*:*) + echo powerpc-unknown-linux-"$LIBC" + exit ;; + ppc64le:Linux:*:*) + echo powerpc64le-unknown-linux-"$LIBC" + exit ;; + ppcle:Linux:*:*) + echo powerpcle-unknown-linux-"$LIBC" + exit ;; + riscv32:Linux:*:* | riscv32be:Linux:*:* | riscv64:Linux:*:* | riscv64be:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + s390:Linux:*:* | s390x:Linux:*:*) + echo "$UNAME_MACHINE"-ibm-linux-"$LIBC" + exit ;; + sh64*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + sh*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + sparc:Linux:*:* | sparc64:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + tile*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + vax:Linux:*:*) + echo "$UNAME_MACHINE"-dec-linux-"$LIBC" + exit ;; + x86_64:Linux:*:*) + set_cc_for_build + LIBCABI=$LIBC + if test "$CC_FOR_BUILD" != no_compiler_found; then + if (echo '#ifdef __ILP32__'; echo IS_X32; echo '#endif') | \ + (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \ + grep IS_X32 >/dev/null + then + LIBCABI="$LIBC"x32 + fi + fi + echo "$UNAME_MACHINE"-pc-linux-"$LIBCABI" + exit ;; + xtensa*:Linux:*:*) + echo "$UNAME_MACHINE"-unknown-linux-"$LIBC" + exit ;; + i*86:DYNIX/ptx:4*:*) + # ptx 4.0 does uname -s correctly, with DYNIX/ptx in there. + # earlier versions are messed up and put the nodename in both + # sysname and nodename. + echo i386-sequent-sysv4 + exit ;; + i*86:UNIX_SV:4.2MP:2.*) + # Unixware is an offshoot of SVR4, but it has its own version + # number series starting with 2... + # I am not positive that other SVR4 systems won't match this, + # I just have to hope. -- rms. + # Use sysv4.2uw... so that sysv4* matches it. + echo "$UNAME_MACHINE"-pc-sysv4.2uw"$UNAME_VERSION" + exit ;; + i*86:OS/2:*:*) + # If we were able to find `uname', then EMX Unix compatibility + # is probably installed. + echo "$UNAME_MACHINE"-pc-os2-emx + exit ;; + i*86:XTS-300:*:STOP) + echo "$UNAME_MACHINE"-unknown-stop + exit ;; + i*86:atheos:*:*) + echo "$UNAME_MACHINE"-unknown-atheos + exit ;; + i*86:syllable:*:*) + echo "$UNAME_MACHINE"-pc-syllable + exit ;; + i*86:LynxOS:2.*:* | i*86:LynxOS:3.[01]*:* | i*86:LynxOS:4.[02]*:*) + echo i386-unknown-lynxos"$UNAME_RELEASE" + exit ;; + i*86:*DOS:*:*) + echo "$UNAME_MACHINE"-pc-msdosdjgpp + exit ;; + i*86:*:4.*:*) + UNAME_REL=$(echo "$UNAME_RELEASE" | sed 's/\/MP$//') + if grep Novell /usr/include/link.h >/dev/null 2>/dev/null; then + echo "$UNAME_MACHINE"-univel-sysv"$UNAME_REL" + else + echo "$UNAME_MACHINE"-pc-sysv"$UNAME_REL" + fi + exit ;; + i*86:*:5:[678]*) + # UnixWare 7.x, OpenUNIX and OpenServer 6. + case $(/bin/uname -X | grep "^Machine") in + *486*) UNAME_MACHINE=i486 ;; + *Pentium) UNAME_MACHINE=i586 ;; + *Pent*|*Celeron) UNAME_MACHINE=i686 ;; + esac + echo "$UNAME_MACHINE-unknown-sysv${UNAME_RELEASE}${UNAME_SYSTEM}${UNAME_VERSION}" + exit ;; + i*86:*:3.2:*) + if test -f /usr/options/cb.name; then + UNAME_REL=$(sed -n 's/.*Version //p' /dev/null >/dev/null ; then + UNAME_REL=$( (/bin/uname -X|grep Release|sed -e 's/.*= //')) + (/bin/uname -X|grep i80486 >/dev/null) && UNAME_MACHINE=i486 + (/bin/uname -X|grep '^Machine.*Pentium' >/dev/null) \ + && UNAME_MACHINE=i586 + (/bin/uname -X|grep '^Machine.*Pent *II' >/dev/null) \ + && UNAME_MACHINE=i686 + (/bin/uname -X|grep '^Machine.*Pentium Pro' >/dev/null) \ + && UNAME_MACHINE=i686 + echo "$UNAME_MACHINE"-pc-sco"$UNAME_REL" + else + echo "$UNAME_MACHINE"-pc-sysv32 + fi + exit ;; + pc:*:*:*) + # Left here for compatibility: + # uname -m prints for DJGPP always 'pc', but it prints nothing about + # the processor, so we play safe by assuming i586. + # Note: whatever this is, it MUST be the same as what config.sub + # prints for the "djgpp" host, or else GDB configure will decide that + # this is a cross-build. + echo i586-pc-msdosdjgpp + exit ;; + Intel:Mach:3*:*) + echo i386-pc-mach3 + exit ;; + paragon:*:*:*) + echo i860-intel-osf1 + exit ;; + i860:*:4.*:*) # i860-SVR4 + if grep Stardent /usr/include/sys/uadmin.h >/dev/null 2>&1 ; then + echo i860-stardent-sysv"$UNAME_RELEASE" # Stardent Vistra i860-SVR4 + else # Add other i860-SVR4 vendors below as they are discovered. + echo i860-unknown-sysv"$UNAME_RELEASE" # Unknown i860-SVR4 + fi + exit ;; + mini*:CTIX:SYS*5:*) + # "miniframe" + echo m68010-convergent-sysv + exit ;; + mc68k:UNIX:SYSTEM5:3.51m) + echo m68k-convergent-sysv + exit ;; + M680?0:D-NIX:5.3:*) + echo m68k-diab-dnix + exit ;; + M68*:*:R3V[5678]*:*) + test -r /sysV68 && { echo 'm68k-motorola-sysv'; exit; } ;; + 3[345]??:*:4.0:3.0 | 3[34]??A:*:4.0:3.0 | 3[34]??,*:*:4.0:3.0 | 3[34]??/*:*:4.0:3.0 | 4400:*:4.0:3.0 | 4850:*:4.0:3.0 | SKA40:*:4.0:3.0 | SDS2:*:4.0:3.0 | SHG2:*:4.0:3.0 | S7501*:*:4.0:3.0) + OS_REL='' + test -r /etc/.relid \ + && OS_REL=.$(sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid) + /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ + && { echo i486-ncr-sysv4.3"$OS_REL"; exit; } + /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \ + && { echo i586-ncr-sysv4.3"$OS_REL"; exit; } ;; + 3[34]??:*:4.0:* | 3[34]??,*:*:4.0:*) + /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ + && { echo i486-ncr-sysv4; exit; } ;; + NCR*:*:4.2:* | MPRAS*:*:4.2:*) + OS_REL='.3' + test -r /etc/.relid \ + && OS_REL=.$(sed -n 's/[^ ]* [^ ]* \([0-9][0-9]\).*/\1/p' < /etc/.relid) + /bin/uname -p 2>/dev/null | grep 86 >/dev/null \ + && { echo i486-ncr-sysv4.3"$OS_REL"; exit; } + /bin/uname -p 2>/dev/null | /bin/grep entium >/dev/null \ + && { echo i586-ncr-sysv4.3"$OS_REL"; exit; } + /bin/uname -p 2>/dev/null | /bin/grep pteron >/dev/null \ + && { echo i586-ncr-sysv4.3"$OS_REL"; exit; } ;; + m68*:LynxOS:2.*:* | m68*:LynxOS:3.0*:*) + echo m68k-unknown-lynxos"$UNAME_RELEASE" + exit ;; + mc68030:UNIX_System_V:4.*:*) + echo m68k-atari-sysv4 + exit ;; + TSUNAMI:LynxOS:2.*:*) + echo sparc-unknown-lynxos"$UNAME_RELEASE" + exit ;; + rs6000:LynxOS:2.*:*) + echo rs6000-unknown-lynxos"$UNAME_RELEASE" + exit ;; + PowerPC:LynxOS:2.*:* | PowerPC:LynxOS:3.[01]*:* | PowerPC:LynxOS:4.[02]*:*) + echo powerpc-unknown-lynxos"$UNAME_RELEASE" + exit ;; + SM[BE]S:UNIX_SV:*:*) + echo mips-dde-sysv"$UNAME_RELEASE" + exit ;; + RM*:ReliantUNIX-*:*:*) + echo mips-sni-sysv4 + exit ;; + RM*:SINIX-*:*:*) + echo mips-sni-sysv4 + exit ;; + *:SINIX-*:*:*) + if uname -p 2>/dev/null >/dev/null ; then + UNAME_MACHINE=$( (uname -p) 2>/dev/null) + echo "$UNAME_MACHINE"-sni-sysv4 + else + echo ns32k-sni-sysv + fi + exit ;; + PENTIUM:*:4.0*:*) # Unisys `ClearPath HMP IX 4000' SVR4/MP effort + # says + echo i586-unisys-sysv4 + exit ;; + *:UNIX_System_V:4*:FTX*) + # From Gerald Hewes . + # How about differentiating between stratus architectures? -djm + echo hppa1.1-stratus-sysv4 + exit ;; + *:*:*:FTX*) + # From seanf@swdc.stratus.com. + echo i860-stratus-sysv4 + exit ;; + i*86:VOS:*:*) + # From Paul.Green@stratus.com. + echo "$UNAME_MACHINE"-stratus-vos + exit ;; + *:VOS:*:*) + # From Paul.Green@stratus.com. + echo hppa1.1-stratus-vos + exit ;; + mc68*:A/UX:*:*) + echo m68k-apple-aux"$UNAME_RELEASE" + exit ;; + news*:NEWS-OS:6*:*) + echo mips-sony-newsos6 + exit ;; + R[34]000:*System_V*:*:* | R4000:UNIX_SYSV:*:* | R*000:UNIX_SV:*:*) + if test -d /usr/nec; then + echo mips-nec-sysv"$UNAME_RELEASE" + else + echo mips-unknown-sysv"$UNAME_RELEASE" + fi + exit ;; + BeBox:BeOS:*:*) # BeOS running on hardware made by Be, PPC only. + echo powerpc-be-beos + exit ;; + BeMac:BeOS:*:*) # BeOS running on Mac or Mac clone, PPC only. + echo powerpc-apple-beos + exit ;; + BePC:BeOS:*:*) # BeOS running on Intel PC compatible. + echo i586-pc-beos + exit ;; + BePC:Haiku:*:*) # Haiku running on Intel PC compatible. + echo i586-pc-haiku + exit ;; + x86_64:Haiku:*:*) + echo x86_64-unknown-haiku + exit ;; + SX-4:SUPER-UX:*:*) + echo sx4-nec-superux"$UNAME_RELEASE" + exit ;; + SX-5:SUPER-UX:*:*) + echo sx5-nec-superux"$UNAME_RELEASE" + exit ;; + SX-6:SUPER-UX:*:*) + echo sx6-nec-superux"$UNAME_RELEASE" + exit ;; + SX-7:SUPER-UX:*:*) + echo sx7-nec-superux"$UNAME_RELEASE" + exit ;; + SX-8:SUPER-UX:*:*) + echo sx8-nec-superux"$UNAME_RELEASE" + exit ;; + SX-8R:SUPER-UX:*:*) + echo sx8r-nec-superux"$UNAME_RELEASE" + exit ;; + SX-ACE:SUPER-UX:*:*) + echo sxace-nec-superux"$UNAME_RELEASE" + exit ;; + Power*:Rhapsody:*:*) + echo powerpc-apple-rhapsody"$UNAME_RELEASE" + exit ;; + *:Rhapsody:*:*) + echo "$UNAME_MACHINE"-apple-rhapsody"$UNAME_RELEASE" + exit ;; + arm64:Darwin:*:*) + echo aarch64-apple-darwin"$UNAME_RELEASE" + exit ;; + *:Darwin:*:*) + UNAME_PROCESSOR=$(uname -p) + case $UNAME_PROCESSOR in + unknown) UNAME_PROCESSOR=powerpc ;; + esac + if command -v xcode-select > /dev/null 2> /dev/null && \ + ! xcode-select --print-path > /dev/null 2> /dev/null ; then + # Avoid executing cc if there is no toolchain installed as + # cc will be a stub that puts up a graphical alert + # prompting the user to install developer tools. + CC_FOR_BUILD=no_compiler_found + else + set_cc_for_build + fi + if test "$CC_FOR_BUILD" != no_compiler_found; then + if (echo '#ifdef __LP64__'; echo IS_64BIT_ARCH; echo '#endif') | \ + (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \ + grep IS_64BIT_ARCH >/dev/null + then + case $UNAME_PROCESSOR in + i386) UNAME_PROCESSOR=x86_64 ;; + powerpc) UNAME_PROCESSOR=powerpc64 ;; + esac + fi + # On 10.4-10.6 one might compile for PowerPC via gcc -arch ppc + if (echo '#ifdef __POWERPC__'; echo IS_PPC; echo '#endif') | \ + (CCOPTS="" $CC_FOR_BUILD -E - 2>/dev/null) | \ + grep IS_PPC >/dev/null + then + UNAME_PROCESSOR=powerpc + fi + elif test "$UNAME_PROCESSOR" = i386 ; then + # uname -m returns i386 or x86_64 + UNAME_PROCESSOR=$UNAME_MACHINE + fi + echo "$UNAME_PROCESSOR"-apple-darwin"$UNAME_RELEASE" + exit ;; + *:procnto*:*:* | *:QNX:[0123456789]*:*) + UNAME_PROCESSOR=$(uname -p) + if test "$UNAME_PROCESSOR" = x86; then + UNAME_PROCESSOR=i386 + UNAME_MACHINE=pc + fi + echo "$UNAME_PROCESSOR"-"$UNAME_MACHINE"-nto-qnx"$UNAME_RELEASE" + exit ;; + *:QNX:*:4*) + echo i386-pc-qnx + exit ;; + NEO-*:NONSTOP_KERNEL:*:*) + echo neo-tandem-nsk"$UNAME_RELEASE" + exit ;; + NSE-*:NONSTOP_KERNEL:*:*) + echo nse-tandem-nsk"$UNAME_RELEASE" + exit ;; + NSR-*:NONSTOP_KERNEL:*:*) + echo nsr-tandem-nsk"$UNAME_RELEASE" + exit ;; + NSV-*:NONSTOP_KERNEL:*:*) + echo nsv-tandem-nsk"$UNAME_RELEASE" + exit ;; + NSX-*:NONSTOP_KERNEL:*:*) + echo nsx-tandem-nsk"$UNAME_RELEASE" + exit ;; + *:NonStop-UX:*:*) + echo mips-compaq-nonstopux + exit ;; + BS2000:POSIX*:*:*) + echo bs2000-siemens-sysv + exit ;; + DS/*:UNIX_System_V:*:*) + echo "$UNAME_MACHINE"-"$UNAME_SYSTEM"-"$UNAME_RELEASE" + exit ;; + *:Plan9:*:*) + # "uname -m" is not consistent, so use $cputype instead. 386 + # is converted to i386 for consistency with other x86 + # operating systems. + # shellcheck disable=SC2154 + if test "$cputype" = 386; then + UNAME_MACHINE=i386 + else + UNAME_MACHINE="$cputype" + fi + echo "$UNAME_MACHINE"-unknown-plan9 + exit ;; + *:TOPS-10:*:*) + echo pdp10-unknown-tops10 + exit ;; + *:TENEX:*:*) + echo pdp10-unknown-tenex + exit ;; + KS10:TOPS-20:*:* | KL10:TOPS-20:*:* | TYPE4:TOPS-20:*:*) + echo pdp10-dec-tops20 + exit ;; + XKL-1:TOPS-20:*:* | TYPE5:TOPS-20:*:*) + echo pdp10-xkl-tops20 + exit ;; + *:TOPS-20:*:*) + echo pdp10-unknown-tops20 + exit ;; + *:ITS:*:*) + echo pdp10-unknown-its + exit ;; + SEI:*:*:SEIUX) + echo mips-sei-seiux"$UNAME_RELEASE" + exit ;; + *:DragonFly:*:*) + echo "$UNAME_MACHINE"-unknown-dragonfly"$(echo "$UNAME_RELEASE"|sed -e 's/[-(].*//')" + exit ;; + *:*VMS:*:*) + UNAME_MACHINE=$( (uname -p) 2>/dev/null) + case "$UNAME_MACHINE" in + A*) echo alpha-dec-vms ; exit ;; + I*) echo ia64-dec-vms ; exit ;; + V*) echo vax-dec-vms ; exit ;; + esac ;; + *:XENIX:*:SysV) + echo i386-pc-xenix + exit ;; + i*86:skyos:*:*) + echo "$UNAME_MACHINE"-pc-skyos"$(echo "$UNAME_RELEASE" | sed -e 's/ .*$//')" + exit ;; + i*86:rdos:*:*) + echo "$UNAME_MACHINE"-pc-rdos + exit ;; + *:AROS:*:*) + echo "$UNAME_MACHINE"-unknown-aros + exit ;; + x86_64:VMkernel:*:*) + echo "$UNAME_MACHINE"-unknown-esx + exit ;; + amd64:Isilon\ OneFS:*:*) + echo x86_64-unknown-onefs + exit ;; + *:Unleashed:*:*) + echo "$UNAME_MACHINE"-unknown-unleashed"$UNAME_RELEASE" + exit ;; +esac + +# No uname command or uname output not recognized. +set_cc_for_build +cat > "$dummy.c" < +#include +#endif +#if defined(ultrix) || defined(_ultrix) || defined(__ultrix) || defined(__ultrix__) +#if defined (vax) || defined (__vax) || defined (__vax__) || defined(mips) || defined(__mips) || defined(__mips__) || defined(MIPS) || defined(__MIPS__) +#include +#if defined(_SIZE_T_) || defined(SIGLOST) +#include +#endif +#endif +#endif +main () +{ +#if defined (sony) +#if defined (MIPSEB) + /* BFD wants "bsd" instead of "newsos". Perhaps BFD should be changed, + I don't know.... */ + printf ("mips-sony-bsd\n"); exit (0); +#else +#include + printf ("m68k-sony-newsos%s\n", +#ifdef NEWSOS4 + "4" +#else + "" +#endif + ); exit (0); +#endif +#endif + +#if defined (NeXT) +#if !defined (__ARCHITECTURE__) +#define __ARCHITECTURE__ "m68k" +#endif + int version; + version=$( (hostinfo | sed -n 's/.*NeXT Mach \([0-9]*\).*/\1/p') 2>/dev/null); + if (version < 4) + printf ("%s-next-nextstep%d\n", __ARCHITECTURE__, version); + else + printf ("%s-next-openstep%d\n", __ARCHITECTURE__, version); + exit (0); +#endif + +#if defined (MULTIMAX) || defined (n16) +#if defined (UMAXV) + printf ("ns32k-encore-sysv\n"); exit (0); +#else +#if defined (CMU) + printf ("ns32k-encore-mach\n"); exit (0); +#else + printf ("ns32k-encore-bsd\n"); exit (0); +#endif +#endif +#endif + +#if defined (__386BSD__) + printf ("i386-pc-bsd\n"); exit (0); +#endif + +#if defined (sequent) +#if defined (i386) + printf ("i386-sequent-dynix\n"); exit (0); +#endif +#if defined (ns32000) + printf ("ns32k-sequent-dynix\n"); exit (0); +#endif +#endif + +#if defined (_SEQUENT_) + struct utsname un; + + uname(&un); + if (strncmp(un.version, "V2", 2) == 0) { + printf ("i386-sequent-ptx2\n"); exit (0); + } + if (strncmp(un.version, "V1", 2) == 0) { /* XXX is V1 correct? */ + printf ("i386-sequent-ptx1\n"); exit (0); + } + printf ("i386-sequent-ptx\n"); exit (0); +#endif + +#if defined (vax) +#if !defined (ultrix) +#include +#if defined (BSD) +#if BSD == 43 + printf ("vax-dec-bsd4.3\n"); exit (0); +#else +#if BSD == 199006 + printf ("vax-dec-bsd4.3reno\n"); exit (0); +#else + printf ("vax-dec-bsd\n"); exit (0); +#endif +#endif +#else + printf ("vax-dec-bsd\n"); exit (0); +#endif +#else +#if defined(_SIZE_T_) || defined(SIGLOST) + struct utsname un; + uname (&un); + printf ("vax-dec-ultrix%s\n", un.release); exit (0); +#else + printf ("vax-dec-ultrix\n"); exit (0); +#endif +#endif +#endif +#if defined(ultrix) || defined(_ultrix) || defined(__ultrix) || defined(__ultrix__) +#if defined(mips) || defined(__mips) || defined(__mips__) || defined(MIPS) || defined(__MIPS__) +#if defined(_SIZE_T_) || defined(SIGLOST) + struct utsname *un; + uname (&un); + printf ("mips-dec-ultrix%s\n", un.release); exit (0); +#else + printf ("mips-dec-ultrix\n"); exit (0); +#endif +#endif +#endif + +#if defined (alliant) && defined (i860) + printf ("i860-alliant-bsd\n"); exit (0); +#endif + + exit (1); +} +EOF + +$CC_FOR_BUILD -o "$dummy" "$dummy.c" 2>/dev/null && SYSTEM_NAME=$($dummy) && + { echo "$SYSTEM_NAME"; exit; } + +# Apollos put the system type in the environment. +test -d /usr/apollo && { echo "$ISP-apollo-$SYSTYPE"; exit; } + +echo "$0: unable to guess system type" >&2 + +case "$UNAME_MACHINE:$UNAME_SYSTEM" in + mips:Linux | mips64:Linux) + # If we got here on MIPS GNU/Linux, output extra information. + cat >&2 <&2 <&2 </dev/null || echo unknown) +uname -r = $( (uname -r) 2>/dev/null || echo unknown) +uname -s = $( (uname -s) 2>/dev/null || echo unknown) +uname -v = $( (uname -v) 2>/dev/null || echo unknown) + +/usr/bin/uname -p = $( (/usr/bin/uname -p) 2>/dev/null) +/bin/uname -X = $( (/bin/uname -X) 2>/dev/null) + +hostinfo = $( (hostinfo) 2>/dev/null) +/bin/universe = $( (/bin/universe) 2>/dev/null) +/usr/bin/arch -k = $( (/usr/bin/arch -k) 2>/dev/null) +/bin/arch = $( (/bin/arch) 2>/dev/null) +/usr/bin/oslevel = $( (/usr/bin/oslevel) 2>/dev/null) +/usr/convex/getsysinfo = $( (/usr/convex/getsysinfo) 2>/dev/null) + +UNAME_MACHINE = "$UNAME_MACHINE" +UNAME_RELEASE = "$UNAME_RELEASE" +UNAME_SYSTEM = "$UNAME_SYSTEM" +UNAME_VERSION = "$UNAME_VERSION" +EOF +fi + +exit 1 + +# Local variables: +# eval: (add-hook 'before-save-hook 'time-stamp) +# time-stamp-start: "timestamp='" +# time-stamp-format: "%:y-%02m-%02d" +# time-stamp-end: "'" +# End: diff --git a/build-aux/config.sub b/build-aux/config.sub new file mode 100755 index 0000000..63c1f1c --- /dev/null +++ b/build-aux/config.sub @@ -0,0 +1,1860 @@ +#! /bin/sh +# Configuration validation subroutine script. +# Copyright 1992-2021 Free Software Foundation, Inc. + +timestamp='2021-01-08' + +# This file is free software; you can redistribute it and/or modify it +# under the terms of the GNU General Public License as published by +# the Free Software Foundation; either version 3 of the License, or +# (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, but +# WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +# General Public License for more details. +# +# You should have received a copy of the GNU General Public License +# along with this program; if not, see . +# +# As a special exception to the GNU General Public License, if you +# distribute this file as part of a program that contains a +# configuration script generated by Autoconf, you may include it under +# the same distribution terms that you use for the rest of that +# program. This Exception is an additional permission under section 7 +# of the GNU General Public License, version 3 ("GPLv3"). + + +# Please send patches to . +# +# Configuration subroutine to validate and canonicalize a configuration type. +# Supply the specified configuration type as an argument. +# If it is invalid, we print an error message on stderr and exit with code 1. +# Otherwise, we print the canonical config type on stdout and succeed. + +# You can get the latest version of this script from: +# https://git.savannah.gnu.org/cgit/config.git/plain/config.sub + +# This file is supposed to be the same for all GNU packages +# and recognize all the CPU types, system types and aliases +# that are meaningful with *any* GNU software. +# Each package is responsible for reporting which valid configurations +# it does not support. The user should be able to distinguish +# a failure to support a valid configuration from a meaningless +# configuration. + +# The goal of this file is to map all the various variations of a given +# machine specification into a single specification in the form: +# CPU_TYPE-MANUFACTURER-OPERATING_SYSTEM +# or in some cases, the newer four-part form: +# CPU_TYPE-MANUFACTURER-KERNEL-OPERATING_SYSTEM +# It is wrong to echo any other type of specification. + +me=$(echo "$0" | sed -e 's,.*/,,') + +usage="\ +Usage: $0 [OPTION] CPU-MFR-OPSYS or ALIAS + +Canonicalize a configuration name. + +Options: + -h, --help print this help, then exit + -t, --time-stamp print date of last modification, then exit + -v, --version print version number, then exit + +Report bugs and patches to ." + +version="\ +GNU config.sub ($timestamp) + +Copyright 1992-2021 Free Software Foundation, Inc. + +This is free software; see the source for copying conditions. There is NO +warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE." + +help=" +Try \`$me --help' for more information." + +# Parse command line +while test $# -gt 0 ; do + case $1 in + --time-stamp | --time* | -t ) + echo "$timestamp" ; exit ;; + --version | -v ) + echo "$version" ; exit ;; + --help | --h* | -h ) + echo "$usage"; exit ;; + -- ) # Stop option processing + shift; break ;; + - ) # Use stdin as input. + break ;; + -* ) + echo "$me: invalid option $1$help" >&2 + exit 1 ;; + + *local*) + # First pass through any local machine types. + echo "$1" + exit ;; + + * ) + break ;; + esac +done + +case $# in + 0) echo "$me: missing argument$help" >&2 + exit 1;; + 1) ;; + *) echo "$me: too many arguments$help" >&2 + exit 1;; +esac + +# Split fields of configuration type +# shellcheck disable=SC2162 +IFS="-" read field1 field2 field3 field4 <&2 + exit 1 + ;; + *-*-*-*) + basic_machine=$field1-$field2 + basic_os=$field3-$field4 + ;; + *-*-*) + # Ambiguous whether COMPANY is present, or skipped and KERNEL-OS is two + # parts + maybe_os=$field2-$field3 + case $maybe_os in + nto-qnx* | linux-* | uclinux-uclibc* \ + | uclinux-gnu* | kfreebsd*-gnu* | knetbsd*-gnu* | netbsd*-gnu* \ + | netbsd*-eabi* | kopensolaris*-gnu* | cloudabi*-eabi* \ + | storm-chaos* | os2-emx* | rtmk-nova*) + basic_machine=$field1 + basic_os=$maybe_os + ;; + android-linux) + basic_machine=$field1-unknown + basic_os=linux-android + ;; + *) + basic_machine=$field1-$field2 + basic_os=$field3 + ;; + esac + ;; + *-*) + # A lone config we happen to match not fitting any pattern + case $field1-$field2 in + decstation-3100) + basic_machine=mips-dec + basic_os= + ;; + *-*) + # Second component is usually, but not always the OS + case $field2 in + # Prevent following clause from handling this valid os + sun*os*) + basic_machine=$field1 + basic_os=$field2 + ;; + # Manufacturers + dec* | mips* | sequent* | encore* | pc533* | sgi* | sony* \ + | att* | 7300* | 3300* | delta* | motorola* | sun[234]* \ + | unicom* | ibm* | next | hp | isi* | apollo | altos* \ + | convergent* | ncr* | news | 32* | 3600* | 3100* \ + | hitachi* | c[123]* | convex* | sun | crds | omron* | dg \ + | ultra | tti* | harris | dolphin | highlevel | gould \ + | cbm | ns | masscomp | apple | axis | knuth | cray \ + | microblaze* | sim | cisco \ + | oki | wec | wrs | winbond) + basic_machine=$field1-$field2 + basic_os= + ;; + *) + basic_machine=$field1 + basic_os=$field2 + ;; + esac + ;; + esac + ;; + *) + # Convert single-component short-hands not valid as part of + # multi-component configurations. + case $field1 in + 386bsd) + basic_machine=i386-pc + basic_os=bsd + ;; + a29khif) + basic_machine=a29k-amd + basic_os=udi + ;; + adobe68k) + basic_machine=m68010-adobe + basic_os=scout + ;; + alliant) + basic_machine=fx80-alliant + basic_os= + ;; + altos | altos3068) + basic_machine=m68k-altos + basic_os= + ;; + am29k) + basic_machine=a29k-none + basic_os=bsd + ;; + amdahl) + basic_machine=580-amdahl + basic_os=sysv + ;; + amiga) + basic_machine=m68k-unknown + basic_os= + ;; + amigaos | amigados) + basic_machine=m68k-unknown + basic_os=amigaos + ;; + amigaunix | amix) + basic_machine=m68k-unknown + basic_os=sysv4 + ;; + apollo68) + basic_machine=m68k-apollo + basic_os=sysv + ;; + apollo68bsd) + basic_machine=m68k-apollo + basic_os=bsd + ;; + aros) + basic_machine=i386-pc + basic_os=aros + ;; + aux) + basic_machine=m68k-apple + basic_os=aux + ;; + balance) + basic_machine=ns32k-sequent + basic_os=dynix + ;; + blackfin) + basic_machine=bfin-unknown + basic_os=linux + ;; + cegcc) + basic_machine=arm-unknown + basic_os=cegcc + ;; + convex-c1) + basic_machine=c1-convex + basic_os=bsd + ;; + convex-c2) + basic_machine=c2-convex + basic_os=bsd + ;; + convex-c32) + basic_machine=c32-convex + basic_os=bsd + ;; + convex-c34) + basic_machine=c34-convex + basic_os=bsd + ;; + convex-c38) + basic_machine=c38-convex + basic_os=bsd + ;; + cray) + basic_machine=j90-cray + basic_os=unicos + ;; + crds | unos) + basic_machine=m68k-crds + basic_os= + ;; + da30) + basic_machine=m68k-da30 + basic_os= + ;; + decstation | pmax | pmin | dec3100 | decstatn) + basic_machine=mips-dec + basic_os= + ;; + delta88) + basic_machine=m88k-motorola + basic_os=sysv3 + ;; + dicos) + basic_machine=i686-pc + basic_os=dicos + ;; + djgpp) + basic_machine=i586-pc + basic_os=msdosdjgpp + ;; + ebmon29k) + basic_machine=a29k-amd + basic_os=ebmon + ;; + es1800 | OSE68k | ose68k | ose | OSE) + basic_machine=m68k-ericsson + basic_os=ose + ;; + gmicro) + basic_machine=tron-gmicro + basic_os=sysv + ;; + go32) + basic_machine=i386-pc + basic_os=go32 + ;; + h8300hms) + basic_machine=h8300-hitachi + basic_os=hms + ;; + h8300xray) + basic_machine=h8300-hitachi + basic_os=xray + ;; + h8500hms) + basic_machine=h8500-hitachi + basic_os=hms + ;; + harris) + basic_machine=m88k-harris + basic_os=sysv3 + ;; + hp300 | hp300hpux) + basic_machine=m68k-hp + basic_os=hpux + ;; + hp300bsd) + basic_machine=m68k-hp + basic_os=bsd + ;; + hppaosf) + basic_machine=hppa1.1-hp + basic_os=osf + ;; + hppro) + basic_machine=hppa1.1-hp + basic_os=proelf + ;; + i386mach) + basic_machine=i386-mach + basic_os=mach + ;; + isi68 | isi) + basic_machine=m68k-isi + basic_os=sysv + ;; + m68knommu) + basic_machine=m68k-unknown + basic_os=linux + ;; + magnum | m3230) + basic_machine=mips-mips + basic_os=sysv + ;; + merlin) + basic_machine=ns32k-utek + basic_os=sysv + ;; + mingw64) + basic_machine=x86_64-pc + basic_os=mingw64 + ;; + mingw32) + basic_machine=i686-pc + basic_os=mingw32 + ;; + mingw32ce) + basic_machine=arm-unknown + basic_os=mingw32ce + ;; + monitor) + basic_machine=m68k-rom68k + basic_os=coff + ;; + morphos) + basic_machine=powerpc-unknown + basic_os=morphos + ;; + moxiebox) + basic_machine=moxie-unknown + basic_os=moxiebox + ;; + msdos) + basic_machine=i386-pc + basic_os=msdos + ;; + msys) + basic_machine=i686-pc + basic_os=msys + ;; + mvs) + basic_machine=i370-ibm + basic_os=mvs + ;; + nacl) + basic_machine=le32-unknown + basic_os=nacl + ;; + ncr3000) + basic_machine=i486-ncr + basic_os=sysv4 + ;; + netbsd386) + basic_machine=i386-pc + basic_os=netbsd + ;; + netwinder) + basic_machine=armv4l-rebel + basic_os=linux + ;; + news | news700 | news800 | news900) + basic_machine=m68k-sony + basic_os=newsos + ;; + news1000) + basic_machine=m68030-sony + basic_os=newsos + ;; + necv70) + basic_machine=v70-nec + basic_os=sysv + ;; + nh3000) + basic_machine=m68k-harris + basic_os=cxux + ;; + nh[45]000) + basic_machine=m88k-harris + basic_os=cxux + ;; + nindy960) + basic_machine=i960-intel + basic_os=nindy + ;; + mon960) + basic_machine=i960-intel + basic_os=mon960 + ;; + nonstopux) + basic_machine=mips-compaq + basic_os=nonstopux + ;; + os400) + basic_machine=powerpc-ibm + basic_os=os400 + ;; + OSE68000 | ose68000) + basic_machine=m68000-ericsson + basic_os=ose + ;; + os68k) + basic_machine=m68k-none + basic_os=os68k + ;; + paragon) + basic_machine=i860-intel + basic_os=osf + ;; + parisc) + basic_machine=hppa-unknown + basic_os=linux + ;; + psp) + basic_machine=mipsallegrexel-sony + basic_os=psp + ;; + pw32) + basic_machine=i586-unknown + basic_os=pw32 + ;; + rdos | rdos64) + basic_machine=x86_64-pc + basic_os=rdos + ;; + rdos32) + basic_machine=i386-pc + basic_os=rdos + ;; + rom68k) + basic_machine=m68k-rom68k + basic_os=coff + ;; + sa29200) + basic_machine=a29k-amd + basic_os=udi + ;; + sei) + basic_machine=mips-sei + basic_os=seiux + ;; + sequent) + basic_machine=i386-sequent + basic_os= + ;; + sps7) + basic_machine=m68k-bull + basic_os=sysv2 + ;; + st2000) + basic_machine=m68k-tandem + basic_os= + ;; + stratus) + basic_machine=i860-stratus + basic_os=sysv4 + ;; + sun2) + basic_machine=m68000-sun + basic_os= + ;; + sun2os3) + basic_machine=m68000-sun + basic_os=sunos3 + ;; + sun2os4) + basic_machine=m68000-sun + basic_os=sunos4 + ;; + sun3) + basic_machine=m68k-sun + basic_os= + ;; + sun3os3) + basic_machine=m68k-sun + basic_os=sunos3 + ;; + sun3os4) + basic_machine=m68k-sun + basic_os=sunos4 + ;; + sun4) + basic_machine=sparc-sun + basic_os= + ;; + sun4os3) + basic_machine=sparc-sun + basic_os=sunos3 + ;; + sun4os4) + basic_machine=sparc-sun + basic_os=sunos4 + ;; + sun4sol2) + basic_machine=sparc-sun + basic_os=solaris2 + ;; + sun386 | sun386i | roadrunner) + basic_machine=i386-sun + basic_os= + ;; + sv1) + basic_machine=sv1-cray + basic_os=unicos + ;; + symmetry) + basic_machine=i386-sequent + basic_os=dynix + ;; + t3e) + basic_machine=alphaev5-cray + basic_os=unicos + ;; + t90) + basic_machine=t90-cray + basic_os=unicos + ;; + toad1) + basic_machine=pdp10-xkl + basic_os=tops20 + ;; + tpf) + basic_machine=s390x-ibm + basic_os=tpf + ;; + udi29k) + basic_machine=a29k-amd + basic_os=udi + ;; + ultra3) + basic_machine=a29k-nyu + basic_os=sym1 + ;; + v810 | necv810) + basic_machine=v810-nec + basic_os=none + ;; + vaxv) + basic_machine=vax-dec + basic_os=sysv + ;; + vms) + basic_machine=vax-dec + basic_os=vms + ;; + vsta) + basic_machine=i386-pc + basic_os=vsta + ;; + vxworks960) + basic_machine=i960-wrs + basic_os=vxworks + ;; + vxworks68) + basic_machine=m68k-wrs + basic_os=vxworks + ;; + vxworks29k) + basic_machine=a29k-wrs + basic_os=vxworks + ;; + xbox) + basic_machine=i686-pc + basic_os=mingw32 + ;; + ymp) + basic_machine=ymp-cray + basic_os=unicos + ;; + *) + basic_machine=$1 + basic_os= + ;; + esac + ;; +esac + +# Decode 1-component or ad-hoc basic machines +case $basic_machine in + # Here we handle the default manufacturer of certain CPU types. It is in + # some cases the only manufacturer, in others, it is the most popular. + w89k) + cpu=hppa1.1 + vendor=winbond + ;; + op50n) + cpu=hppa1.1 + vendor=oki + ;; + op60c) + cpu=hppa1.1 + vendor=oki + ;; + ibm*) + cpu=i370 + vendor=ibm + ;; + orion105) + cpu=clipper + vendor=highlevel + ;; + mac | mpw | mac-mpw) + cpu=m68k + vendor=apple + ;; + pmac | pmac-mpw) + cpu=powerpc + vendor=apple + ;; + + # Recognize the various machine names and aliases which stand + # for a CPU type and a company and sometimes even an OS. + 3b1 | 7300 | 7300-att | att-7300 | pc7300 | safari | unixpc) + cpu=m68000 + vendor=att + ;; + 3b*) + cpu=we32k + vendor=att + ;; + bluegene*) + cpu=powerpc + vendor=ibm + basic_os=cnk + ;; + decsystem10* | dec10*) + cpu=pdp10 + vendor=dec + basic_os=tops10 + ;; + decsystem20* | dec20*) + cpu=pdp10 + vendor=dec + basic_os=tops20 + ;; + delta | 3300 | motorola-3300 | motorola-delta \ + | 3300-motorola | delta-motorola) + cpu=m68k + vendor=motorola + ;; + dpx2*) + cpu=m68k + vendor=bull + basic_os=sysv3 + ;; + encore | umax | mmax) + cpu=ns32k + vendor=encore + ;; + elxsi) + cpu=elxsi + vendor=elxsi + basic_os=${basic_os:-bsd} + ;; + fx2800) + cpu=i860 + vendor=alliant + ;; + genix) + cpu=ns32k + vendor=ns + ;; + h3050r* | hiux*) + cpu=hppa1.1 + vendor=hitachi + basic_os=hiuxwe2 + ;; + hp3k9[0-9][0-9] | hp9[0-9][0-9]) + cpu=hppa1.0 + vendor=hp + ;; + hp9k2[0-9][0-9] | hp9k31[0-9]) + cpu=m68000 + vendor=hp + ;; + hp9k3[2-9][0-9]) + cpu=m68k + vendor=hp + ;; + hp9k6[0-9][0-9] | hp6[0-9][0-9]) + cpu=hppa1.0 + vendor=hp + ;; + hp9k7[0-79][0-9] | hp7[0-79][0-9]) + cpu=hppa1.1 + vendor=hp + ;; + hp9k78[0-9] | hp78[0-9]) + # FIXME: really hppa2.0-hp + cpu=hppa1.1 + vendor=hp + ;; + hp9k8[67]1 | hp8[67]1 | hp9k80[24] | hp80[24] | hp9k8[78]9 | hp8[78]9 | hp9k893 | hp893) + # FIXME: really hppa2.0-hp + cpu=hppa1.1 + vendor=hp + ;; + hp9k8[0-9][13679] | hp8[0-9][13679]) + cpu=hppa1.1 + vendor=hp + ;; + hp9k8[0-9][0-9] | hp8[0-9][0-9]) + cpu=hppa1.0 + vendor=hp + ;; + i*86v32) + cpu=$(echo "$1" | sed -e 's/86.*/86/') + vendor=pc + basic_os=sysv32 + ;; + i*86v4*) + cpu=$(echo "$1" | sed -e 's/86.*/86/') + vendor=pc + basic_os=sysv4 + ;; + i*86v) + cpu=$(echo "$1" | sed -e 's/86.*/86/') + vendor=pc + basic_os=sysv + ;; + i*86sol2) + cpu=$(echo "$1" | sed -e 's/86.*/86/') + vendor=pc + basic_os=solaris2 + ;; + j90 | j90-cray) + cpu=j90 + vendor=cray + basic_os=${basic_os:-unicos} + ;; + iris | iris4d) + cpu=mips + vendor=sgi + case $basic_os in + irix*) + ;; + *) + basic_os=irix4 + ;; + esac + ;; + miniframe) + cpu=m68000 + vendor=convergent + ;; + *mint | mint[0-9]* | *MiNT | *MiNT[0-9]*) + cpu=m68k + vendor=atari + basic_os=mint + ;; + news-3600 | risc-news) + cpu=mips + vendor=sony + basic_os=newsos + ;; + next | m*-next) + cpu=m68k + vendor=next + case $basic_os in + openstep*) + ;; + nextstep*) + ;; + ns2*) + basic_os=nextstep2 + ;; + *) + basic_os=nextstep3 + ;; + esac + ;; + np1) + cpu=np1 + vendor=gould + ;; + op50n-* | op60c-*) + cpu=hppa1.1 + vendor=oki + basic_os=proelf + ;; + pa-hitachi) + cpu=hppa1.1 + vendor=hitachi + basic_os=hiuxwe2 + ;; + pbd) + cpu=sparc + vendor=tti + ;; + pbb) + cpu=m68k + vendor=tti + ;; + pc532) + cpu=ns32k + vendor=pc532 + ;; + pn) + cpu=pn + vendor=gould + ;; + power) + cpu=power + vendor=ibm + ;; + ps2) + cpu=i386 + vendor=ibm + ;; + rm[46]00) + cpu=mips + vendor=siemens + ;; + rtpc | rtpc-*) + cpu=romp + vendor=ibm + ;; + sde) + cpu=mipsisa32 + vendor=sde + basic_os=${basic_os:-elf} + ;; + simso-wrs) + cpu=sparclite + vendor=wrs + basic_os=vxworks + ;; + tower | tower-32) + cpu=m68k + vendor=ncr + ;; + vpp*|vx|vx-*) + cpu=f301 + vendor=fujitsu + ;; + w65) + cpu=w65 + vendor=wdc + ;; + w89k-*) + cpu=hppa1.1 + vendor=winbond + basic_os=proelf + ;; + none) + cpu=none + vendor=none + ;; + leon|leon[3-9]) + cpu=sparc + vendor=$basic_machine + ;; + leon-*|leon[3-9]-*) + cpu=sparc + vendor=$(echo "$basic_machine" | sed 's/-.*//') + ;; + + *-*) + # shellcheck disable=SC2162 + IFS="-" read cpu vendor <&2 + exit 1 + ;; + esac + ;; +esac + +# Here we canonicalize certain aliases for manufacturers. +case $vendor in + digital*) + vendor=dec + ;; + commodore*) + vendor=cbm + ;; + *) + ;; +esac + +# Decode manufacturer-specific aliases for certain operating systems. + +if test x$basic_os != x +then + +# First recognize some ad-hoc caes, or perhaps split kernel-os, or else just +# set os. +case $basic_os in + gnu/linux*) + kernel=linux + os=$(echo $basic_os | sed -e 's|gnu/linux|gnu|') + ;; + os2-emx) + kernel=os2 + os=$(echo $basic_os | sed -e 's|os2-emx|emx|') + ;; + nto-qnx*) + kernel=nto + os=$(echo $basic_os | sed -e 's|nto-qnx|qnx|') + ;; + *-*) + # shellcheck disable=SC2162 + IFS="-" read kernel os <&2 + exit 1 + ;; +esac + +# As a final step for OS-related things, validate the OS-kernel combination +# (given a valid OS), if there is a kernel. +case $kernel-$os in + linux-gnu* | linux-dietlibc* | linux-android* | linux-newlib* | linux-musl* | linux-uclibc* ) + ;; + uclinux-uclibc* ) + ;; + -dietlibc* | -newlib* | -musl* | -uclibc* ) + # These are just libc implementations, not actual OSes, and thus + # require a kernel. + echo "Invalid configuration \`$1': libc \`$os' needs explicit kernel." 1>&2 + exit 1 + ;; + kfreebsd*-gnu* | kopensolaris*-gnu*) + ;; + vxworks-simlinux | vxworks-simwindows | vxworks-spe) + ;; + nto-qnx*) + ;; + os2-emx) + ;; + *-eabi* | *-gnueabi*) + ;; + -*) + # Blank kernel with real OS is always fine. + ;; + *-*) + echo "Invalid configuration \`$1': Kernel \`$kernel' not known to work with OS \`$os'." 1>&2 + exit 1 + ;; +esac + +# Here we handle the case where we know the os, and the CPU type, but not the +# manufacturer. We pick the logical manufacturer. +case $vendor in + unknown) + case $cpu-$os in + *-riscix*) + vendor=acorn + ;; + *-sunos*) + vendor=sun + ;; + *-cnk* | *-aix*) + vendor=ibm + ;; + *-beos*) + vendor=be + ;; + *-hpux*) + vendor=hp + ;; + *-mpeix*) + vendor=hp + ;; + *-hiux*) + vendor=hitachi + ;; + *-unos*) + vendor=crds + ;; + *-dgux*) + vendor=dg + ;; + *-luna*) + vendor=omron + ;; + *-genix*) + vendor=ns + ;; + *-clix*) + vendor=intergraph + ;; + *-mvs* | *-opened*) + vendor=ibm + ;; + *-os400*) + vendor=ibm + ;; + s390-* | s390x-*) + vendor=ibm + ;; + *-ptx*) + vendor=sequent + ;; + *-tpf*) + vendor=ibm + ;; + *-vxsim* | *-vxworks* | *-windiss*) + vendor=wrs + ;; + *-aux*) + vendor=apple + ;; + *-hms*) + vendor=hitachi + ;; + *-mpw* | *-macos*) + vendor=apple + ;; + *-*mint | *-mint[0-9]* | *-*MiNT | *-MiNT[0-9]*) + vendor=atari + ;; + *-vos*) + vendor=stratus + ;; + esac + ;; +esac + +echo "$cpu-$vendor-${kernel:+$kernel-}$os" +exit + +# Local variables: +# eval: (add-hook 'before-save-hook 'time-stamp) +# time-stamp-start: "timestamp='" +# time-stamp-format: "%:y-%02m-%02d" +# time-stamp-end: "'" +# End: diff --git a/build-aux/install-sh b/build-aux/install-sh new file mode 100755 index 0000000..ec298b5 --- /dev/null +++ b/build-aux/install-sh @@ -0,0 +1,541 @@ +#!/bin/sh +# install - install a program, script, or datafile + +scriptversion=2020-11-14.01; # UTC + +# This originates from X11R5 (mit/util/scripts/install.sh), which was +# later released in X11R6 (xc/config/util/install.sh) with the +# following copyright and license. +# +# Copyright (C) 1994 X Consortium +# +# Permission is hereby granted, free of charge, to any person obtaining a copy +# of this software and associated documentation files (the "Software"), to +# deal in the Software without restriction, including without limitation the +# rights to use, copy, modify, merge, publish, distribute, sublicense, and/or +# sell copies of the Software, and to permit persons to whom the Software is +# furnished to do so, subject to the following conditions: +# +# The above copyright notice and this permission notice shall be included in +# all copies or substantial portions of the Software. +# +# THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +# IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +# FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +# X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN +# AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- +# TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. +# +# Except as contained in this notice, the name of the X Consortium shall not +# be used in advertising or otherwise to promote the sale, use or other deal- +# ings in this Software without prior written authorization from the X Consor- +# tium. +# +# +# FSF changes to this file are in the public domain. +# +# Calling this script install-sh is preferred over install.sh, to prevent +# 'make' implicit rules from creating a file called install from it +# when there is no Makefile. +# +# This script is compatible with the BSD install script, but was written +# from scratch. + +tab=' ' +nl=' +' +IFS=" $tab$nl" + +# Set DOITPROG to "echo" to test this script. + +doit=${DOITPROG-} +doit_exec=${doit:-exec} + +# Put in absolute file names if you don't have them in your path; +# or use environment vars. + +chgrpprog=${CHGRPPROG-chgrp} +chmodprog=${CHMODPROG-chmod} +chownprog=${CHOWNPROG-chown} +cmpprog=${CMPPROG-cmp} +cpprog=${CPPROG-cp} +mkdirprog=${MKDIRPROG-mkdir} +mvprog=${MVPROG-mv} +rmprog=${RMPROG-rm} +stripprog=${STRIPPROG-strip} + +posix_mkdir= + +# Desired mode of installed file. +mode=0755 + +# Create dirs (including intermediate dirs) using mode 755. +# This is like GNU 'install' as of coreutils 8.32 (2020). +mkdir_umask=22 + +backupsuffix= +chgrpcmd= +chmodcmd=$chmodprog +chowncmd= +mvcmd=$mvprog +rmcmd="$rmprog -f" +stripcmd= + +src= +dst= +dir_arg= +dst_arg= + +copy_on_change=false +is_target_a_directory=possibly + +usage="\ +Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE + or: $0 [OPTION]... SRCFILES... DIRECTORY + or: $0 [OPTION]... -t DIRECTORY SRCFILES... + or: $0 [OPTION]... -d DIRECTORIES... + +In the 1st form, copy SRCFILE to DSTFILE. +In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. +In the 4th, create DIRECTORIES. + +Options: + --help display this help and exit. + --version display version info and exit. + + -c (ignored) + -C install only if different (preserve data modification time) + -d create directories instead of installing files. + -g GROUP $chgrpprog installed files to GROUP. + -m MODE $chmodprog installed files to MODE. + -o USER $chownprog installed files to USER. + -p pass -p to $cpprog. + -s $stripprog installed files. + -S SUFFIX attempt to back up existing files, with suffix SUFFIX. + -t DIRECTORY install into DIRECTORY. + -T report an error if DSTFILE is a directory. + +Environment variables override the default commands: + CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG + RMPROG STRIPPROG + +By default, rm is invoked with -f; when overridden with RMPROG, +it's up to you to specify -f if you want it. + +If -S is not specified, no backups are attempted. + +Email bug reports to bug-automake@gnu.org. +Automake home page: https://www.gnu.org/software/automake/ +" + +while test $# -ne 0; do + case $1 in + -c) ;; + + -C) copy_on_change=true;; + + -d) dir_arg=true;; + + -g) chgrpcmd="$chgrpprog $2" + shift;; + + --help) echo "$usage"; exit $?;; + + -m) mode=$2 + case $mode in + *' '* | *"$tab"* | *"$nl"* | *'*'* | *'?'* | *'['*) + echo "$0: invalid mode: $mode" >&2 + exit 1;; + esac + shift;; + + -o) chowncmd="$chownprog $2" + shift;; + + -p) cpprog="$cpprog -p";; + + -s) stripcmd=$stripprog;; + + -S) backupsuffix="$2" + shift;; + + -t) + is_target_a_directory=always + dst_arg=$2 + # Protect names problematic for 'test' and other utilities. + case $dst_arg in + -* | [=\(\)!]) dst_arg=./$dst_arg;; + esac + shift;; + + -T) is_target_a_directory=never;; + + --version) echo "$0 $scriptversion"; exit $?;; + + --) shift + break;; + + -*) echo "$0: invalid option: $1" >&2 + exit 1;; + + *) break;; + esac + shift +done + +# We allow the use of options -d and -T together, by making -d +# take the precedence; this is for compatibility with GNU install. + +if test -n "$dir_arg"; then + if test -n "$dst_arg"; then + echo "$0: target directory not allowed when installing a directory." >&2 + exit 1 + fi +fi + +if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then + # When -d is used, all remaining arguments are directories to create. + # When -t is used, the destination is already specified. + # Otherwise, the last argument is the destination. Remove it from $@. + for arg + do + if test -n "$dst_arg"; then + # $@ is not empty: it contains at least $arg. + set fnord "$@" "$dst_arg" + shift # fnord + fi + shift # arg + dst_arg=$arg + # Protect names problematic for 'test' and other utilities. + case $dst_arg in + -* | [=\(\)!]) dst_arg=./$dst_arg;; + esac + done +fi + +if test $# -eq 0; then + if test -z "$dir_arg"; then + echo "$0: no input file specified." >&2 + exit 1 + fi + # It's OK to call 'install-sh -d' without argument. + # This can happen when creating conditional directories. + exit 0 +fi + +if test -z "$dir_arg"; then + if test $# -gt 1 || test "$is_target_a_directory" = always; then + if test ! -d "$dst_arg"; then + echo "$0: $dst_arg: Is not a directory." >&2 + exit 1 + fi + fi +fi + +if test -z "$dir_arg"; then + do_exit='(exit $ret); exit $ret' + trap "ret=129; $do_exit" 1 + trap "ret=130; $do_exit" 2 + trap "ret=141; $do_exit" 13 + trap "ret=143; $do_exit" 15 + + # Set umask so as not to create temps with too-generous modes. + # However, 'strip' requires both read and write access to temps. + case $mode in + # Optimize common cases. + *644) cp_umask=133;; + *755) cp_umask=22;; + + *[0-7]) + if test -z "$stripcmd"; then + u_plus_rw= + else + u_plus_rw='% 200' + fi + cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; + *) + if test -z "$stripcmd"; then + u_plus_rw= + else + u_plus_rw=,u+rw + fi + cp_umask=$mode$u_plus_rw;; + esac +fi + +for src +do + # Protect names problematic for 'test' and other utilities. + case $src in + -* | [=\(\)!]) src=./$src;; + esac + + if test -n "$dir_arg"; then + dst=$src + dstdir=$dst + test -d "$dstdir" + dstdir_status=$? + # Don't chown directories that already exist. + if test $dstdir_status = 0; then + chowncmd="" + fi + else + + # Waiting for this to be detected by the "$cpprog $src $dsttmp" command + # might cause directories to be created, which would be especially bad + # if $src (and thus $dsttmp) contains '*'. + if test ! -f "$src" && test ! -d "$src"; then + echo "$0: $src does not exist." >&2 + exit 1 + fi + + if test -z "$dst_arg"; then + echo "$0: no destination specified." >&2 + exit 1 + fi + dst=$dst_arg + + # If destination is a directory, append the input filename. + if test -d "$dst"; then + if test "$is_target_a_directory" = never; then + echo "$0: $dst_arg: Is a directory" >&2 + exit 1 + fi + dstdir=$dst + dstbase=`basename "$src"` + case $dst in + */) dst=$dst$dstbase;; + *) dst=$dst/$dstbase;; + esac + dstdir_status=0 + else + dstdir=`dirname "$dst"` + test -d "$dstdir" + dstdir_status=$? + fi + fi + + case $dstdir in + */) dstdirslash=$dstdir;; + *) dstdirslash=$dstdir/;; + esac + + obsolete_mkdir_used=false + + if test $dstdir_status != 0; then + case $posix_mkdir in + '') + # With -d, create the new directory with the user-specified mode. + # Otherwise, rely on $mkdir_umask. + if test -n "$dir_arg"; then + mkdir_mode=-m$mode + else + mkdir_mode= + fi + + posix_mkdir=false + # The $RANDOM variable is not portable (e.g., dash). Use it + # here however when possible just to lower collision chance. + tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ + + trap ' + ret=$? + rmdir "$tmpdir/a/b" "$tmpdir/a" "$tmpdir" 2>/dev/null + exit $ret + ' 0 + + # Because "mkdir -p" follows existing symlinks and we likely work + # directly in world-writeable /tmp, make sure that the '$tmpdir' + # directory is successfully created first before we actually test + # 'mkdir -p'. + if (umask $mkdir_umask && + $mkdirprog $mkdir_mode "$tmpdir" && + exec $mkdirprog $mkdir_mode -p -- "$tmpdir/a/b") >/dev/null 2>&1 + then + if test -z "$dir_arg" || { + # Check for POSIX incompatibilities with -m. + # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or + # other-writable bit of parent directory when it shouldn't. + # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. + test_tmpdir="$tmpdir/a" + ls_ld_tmpdir=`ls -ld "$test_tmpdir"` + case $ls_ld_tmpdir in + d????-?r-*) different_mode=700;; + d????-?--*) different_mode=755;; + *) false;; + esac && + $mkdirprog -m$different_mode -p -- "$test_tmpdir" && { + ls_ld_tmpdir_1=`ls -ld "$test_tmpdir"` + test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" + } + } + then posix_mkdir=: + fi + rmdir "$tmpdir/a/b" "$tmpdir/a" "$tmpdir" + else + # Remove any dirs left behind by ancient mkdir implementations. + rmdir ./$mkdir_mode ./-p ./-- "$tmpdir" 2>/dev/null + fi + trap '' 0;; + esac + + if + $posix_mkdir && ( + umask $mkdir_umask && + $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" + ) + then : + else + + # mkdir does not conform to POSIX, + # or it failed possibly due to a race condition. Create the + # directory the slow way, step by step, checking for races as we go. + + case $dstdir in + /*) prefix='/';; + [-=\(\)!]*) prefix='./';; + *) prefix='';; + esac + + oIFS=$IFS + IFS=/ + set -f + set fnord $dstdir + shift + set +f + IFS=$oIFS + + prefixes= + + for d + do + test X"$d" = X && continue + + prefix=$prefix$d + if test -d "$prefix"; then + prefixes= + else + if $posix_mkdir; then + (umask $mkdir_umask && + $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break + # Don't fail if two instances are running concurrently. + test -d "$prefix" || exit 1 + else + case $prefix in + *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; + *) qprefix=$prefix;; + esac + prefixes="$prefixes '$qprefix'" + fi + fi + prefix=$prefix/ + done + + if test -n "$prefixes"; then + # Don't fail if two instances are running concurrently. + (umask $mkdir_umask && + eval "\$doit_exec \$mkdirprog $prefixes") || + test -d "$dstdir" || exit 1 + obsolete_mkdir_used=true + fi + fi + fi + + if test -n "$dir_arg"; then + { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && + { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && + { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || + test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 + else + + # Make a couple of temp file names in the proper directory. + dsttmp=${dstdirslash}_inst.$$_ + rmtmp=${dstdirslash}_rm.$$_ + + # Trap to clean up those temp files at exit. + trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 + + # Copy the file name to the temp name. + (umask $cp_umask && + { test -z "$stripcmd" || { + # Create $dsttmp read-write so that cp doesn't create it read-only, + # which would cause strip to fail. + if test -z "$doit"; then + : >"$dsttmp" # No need to fork-exec 'touch'. + else + $doit touch "$dsttmp" + fi + } + } && + $doit_exec $cpprog "$src" "$dsttmp") && + + # and set any options; do chmod last to preserve setuid bits. + # + # If any of these fail, we abort the whole thing. If we want to + # ignore errors from any of these, just make sure not to ignore + # errors from the above "$doit $cpprog $src $dsttmp" command. + # + { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && + { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && + { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && + { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && + + # If -C, don't bother to copy if it wouldn't change the file. + if $copy_on_change && + old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && + new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && + set -f && + set X $old && old=:$2:$4:$5:$6 && + set X $new && new=:$2:$4:$5:$6 && + set +f && + test "$old" = "$new" && + $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 + then + rm -f "$dsttmp" + else + # If $backupsuffix is set, and the file being installed + # already exists, attempt a backup. Don't worry if it fails, + # e.g., if mv doesn't support -f. + if test -n "$backupsuffix" && test -f "$dst"; then + $doit $mvcmd -f "$dst" "$dst$backupsuffix" 2>/dev/null + fi + + # Rename the file to the real destination. + $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || + + # The rename failed, perhaps because mv can't rename something else + # to itself, or perhaps because mv is so ancient that it does not + # support -f. + { + # Now remove or move aside any old file at destination location. + # We try this two ways since rm can't unlink itself on some + # systems and the destination file might be busy for other + # reasons. In this case, the final cleanup might fail but the new + # file should still install successfully. + { + test ! -f "$dst" || + $doit $rmcmd "$dst" 2>/dev/null || + { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && + { $doit $rmcmd "$rmtmp" 2>/dev/null; :; } + } || + { echo "$0: cannot unlink or rename $dst" >&2 + (exit 1); exit 1 + } + } && + + # Now rename the file to the real destination. + $doit $mvcmd "$dsttmp" "$dst" + } + fi || exit 1 + + trap '' 0 + fi +done + +# Local variables: +# eval: (add-hook 'before-save-hook 'time-stamp) +# time-stamp-start: "scriptversion=" +# time-stamp-format: "%:y-%02m-%02d.%02H" +# time-stamp-time-zone: "UTC0" +# time-stamp-end: "; # UTC" +# End: diff --git a/configure b/configure index 6d51d81..de45002 100755 --- a/configure +++ b/configure @@ -1,9 +1,10 @@ #! /bin/sh # Guess values for system-dependent variables and create Makefiles. -# Generated by GNU Autoconf 2.69 for seedtool-cli 0.10.2. +# Generated by GNU Autoconf 2.71 for seedtool-cli 0.11.0. # # -# Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc. +# Copyright (C) 1992-1996, 1998-2017, 2020-2021 Free Software Foundation, +# Inc. # # # This configure script is free software; the Free Software Foundation @@ -14,14 +15,16 @@ # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh -if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : +as_nop=: +if test ${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1 +then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST -else +else $as_nop case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( @@ -31,46 +34,46 @@ esac fi + +# Reset variables that may have inherited troublesome values from +# the environment. + +# IFS needs to be set, to space, tab, and newline, in precisely that order. +# (If _AS_PATH_WALK were called with IFS unset, it would have the +# side effect of setting IFS to empty, thus disabling word splitting.) +# Quoting is to prevent editors from complaining about space-tab. as_nl=' ' export as_nl -# Printing a long string crashes Solaris 7 /usr/bin/printf. -as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' -as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo -as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo -# Prefer a ksh shell builtin over an external printf program on Solaris, -# but without wasting forks for bash or zsh. -if test -z "$BASH_VERSION$ZSH_VERSION" \ - && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then - as_echo='print -r --' - as_echo_n='print -rn --' -elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then - as_echo='printf %s\n' - as_echo_n='printf %s' -else - if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then - as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' - as_echo_n='/usr/ucb/echo -n' - else - as_echo_body='eval expr "X$1" : "X\\(.*\\)"' - as_echo_n_body='eval - arg=$1; - case $arg in #( - *"$as_nl"*) - expr "X$arg" : "X\\(.*\\)$as_nl"; - arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; - esac; - expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" - ' - export as_echo_n_body - as_echo_n='sh -c $as_echo_n_body as_echo' - fi - export as_echo_body - as_echo='sh -c $as_echo_body as_echo' -fi +IFS=" "" $as_nl" + +PS1='$ ' +PS2='> ' +PS4='+ ' + +# Ensure predictable behavior from utilities with locale-dependent output. +LC_ALL=C +export LC_ALL +LANGUAGE=C +export LANGUAGE + +# We cannot yet rely on "unset" to work, but we need these variables +# to be unset--not just set to an empty or harmless value--now, to +# avoid bugs in old shells (e.g. pre-3.0 UWIN ksh). This construct +# also avoids known problems related to "unset" and subshell syntax +# in other old shells (e.g. bash 2.01 and pdksh 5.2.14). +for as_var in BASH_ENV ENV MAIL MAILPATH CDPATH +do eval test \${$as_var+y} \ + && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : +done + +# Ensure that fds 0, 1, and 2 are open. +if (exec 3>&0) 2>/dev/null; then :; else exec 0&1) 2>/dev/null; then :; else exec 1>/dev/null; fi +if (exec 3>&2) ; then :; else exec 2>/dev/null; fi # The user is always right. -if test "${PATH_SEPARATOR+set}" != set; then +if ${PATH_SEPARATOR+false} :; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || @@ -79,13 +82,6 @@ if test "${PATH_SEPARATOR+set}" != set; then fi -# IFS -# We need space, tab and new line, in precisely that order. Quoting is -# there to prevent editors from complaining about space-tab. -# (If _AS_PATH_WALK were called with IFS unset, it would disable word -# splitting by setting IFS to empty value.) -IFS=" "" $as_nl" - # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( @@ -94,8 +90,12 @@ case $0 in #(( for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + test -r "$as_dir$0" && as_myself=$as_dir$0 && break done IFS=$as_save_IFS @@ -107,30 +107,10 @@ if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then - $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 + printf "%s\n" "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi -# Unset variables that we do not need and which cause bugs (e.g. in -# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" -# suppresses any "Segmentation fault" message there. '((' could -# trigger a bug in pdksh 5.2.14. -for as_var in BASH_ENV ENV MAIL MAILPATH -do eval test x\${$as_var+set} = xset \ - && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : -done -PS1='$ ' -PS2='> ' -PS4='+ ' - -# NLS nuisances. -LC_ALL=C -export LC_ALL -LANGUAGE=C -export LANGUAGE - -# CDPATH. -(unset CDPATH) >/dev/null 2>&1 && unset CDPATH # Use a proper internal environment variable to ensure we don't fall # into an infinite loop, continuously re-executing ourselves. @@ -152,20 +132,22 @@ esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. -$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 -as_fn_exit 255 +printf "%s\n" "$0: could not re-execute with $CONFIG_SHELL" >&2 +exit 255 fi # We don't want this to propagate to other subprocesses. { _as_can_reexec=; unset _as_can_reexec;} if test "x$CONFIG_SHELL" = x; then - as_bourne_compatible="if test -n \"\${ZSH_VERSION+set}\" && (emulate sh) >/dev/null 2>&1; then : + as_bourne_compatible="as_nop=: +if test \${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1 +then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on \${1+\"\$@\"}, which # is contrary to our usage. Disable this feature. alias -g '\${1+\"\$@\"}'='\"\$@\"' setopt NO_GLOB_SUBST -else +else \$as_nop case \`(set -o) 2>/dev/null\` in #( *posix*) : set -o posix ;; #( @@ -185,42 +167,52 @@ as_fn_success || { exitcode=1; echo as_fn_success failed.; } as_fn_failure && { exitcode=1; echo as_fn_failure succeeded.; } as_fn_ret_success || { exitcode=1; echo as_fn_ret_success failed.; } as_fn_ret_failure && { exitcode=1; echo as_fn_ret_failure succeeded.; } -if ( set x; as_fn_ret_success y && test x = \"\$1\" ); then : +if ( set x; as_fn_ret_success y && test x = \"\$1\" ) +then : -else +else \$as_nop exitcode=1; echo positional parameters were not saved. fi test x\$exitcode = x0 || exit 1 +blah=\$(echo \$(echo blah)) +test x\"\$blah\" = xblah || exit 1 test -x / || exit 1" as_suggested=" as_lineno_1=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_1a=\$LINENO as_lineno_2=";as_suggested=$as_suggested$LINENO;as_suggested=$as_suggested" as_lineno_2a=\$LINENO eval 'test \"x\$as_lineno_1'\$as_run'\" != \"x\$as_lineno_2'\$as_run'\" && - test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1 -test \$(( 1 + 1 )) = 2 || exit 1" - if (eval "$as_required") 2>/dev/null; then : + test \"x\`expr \$as_lineno_1'\$as_run' + 1\`\" = \"x\$as_lineno_2'\$as_run'\"' || exit 1" + if (eval "$as_required") 2>/dev/null +then : as_have_required=yes -else +else $as_nop as_have_required=no fi - if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null; then : + if test x$as_have_required = xyes && (eval "$as_suggested") 2>/dev/null +then : -else +else $as_nop as_save_IFS=$IFS; IFS=$PATH_SEPARATOR as_found=false for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac as_found=: case $as_dir in #( /*) for as_base in sh bash ksh sh5; do # Try only shells that exist, to save several forks. - as_shell=$as_dir/$as_base + as_shell=$as_dir$as_base if { test -f "$as_shell" || test -f "$as_shell.exe"; } && - { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$as_shell"; } 2>/dev/null; then : + as_run=a "$as_shell" -c "$as_bourne_compatible""$as_required" 2>/dev/null +then : CONFIG_SHELL=$as_shell as_have_required=yes - if { $as_echo "$as_bourne_compatible""$as_suggested" | as_run=a "$as_shell"; } 2>/dev/null; then : + if as_run=a "$as_shell" -c "$as_bourne_compatible""$as_suggested" 2>/dev/null +then : break 2 fi fi @@ -228,14 +220,21 @@ fi esac as_found=false done -$as_found || { if { test -f "$SHELL" || test -f "$SHELL.exe"; } && - { $as_echo "$as_bourne_compatible""$as_required" | as_run=a "$SHELL"; } 2>/dev/null; then : - CONFIG_SHELL=$SHELL as_have_required=yes -fi; } IFS=$as_save_IFS +if $as_found +then : + +else $as_nop + if { test -f "$SHELL" || test -f "$SHELL.exe"; } && + as_run=a "$SHELL" -c "$as_bourne_compatible""$as_required" 2>/dev/null +then : + CONFIG_SHELL=$SHELL as_have_required=yes +fi +fi - if test "x$CONFIG_SHELL" != x; then : + if test "x$CONFIG_SHELL" != x +then : export CONFIG_SHELL # We cannot yet assume a decent shell, so we have to provide a # neutralization value for shells without unset; and this also @@ -253,18 +252,19 @@ esac exec $CONFIG_SHELL $as_opts "$as_myself" ${1+"$@"} # Admittedly, this is quite paranoid, since all the known shells bail # out after a failed `exec'. -$as_echo "$0: could not re-execute with $CONFIG_SHELL" >&2 +printf "%s\n" "$0: could not re-execute with $CONFIG_SHELL" >&2 exit 255 fi - if test x$as_have_required = xno; then : - $as_echo "$0: This script requires a shell more modern than all" - $as_echo "$0: the shells that I found on your system." - if test x${ZSH_VERSION+set} = xset ; then - $as_echo "$0: In particular, zsh $ZSH_VERSION has bugs and should" - $as_echo "$0: be upgraded to zsh 4.3.4 or later." + if test x$as_have_required = xno +then : + printf "%s\n" "$0: This script requires a shell more modern than all" + printf "%s\n" "$0: the shells that I found on your system." + if test ${ZSH_VERSION+y} ; then + printf "%s\n" "$0: In particular, zsh $ZSH_VERSION has bugs and should" + printf "%s\n" "$0: be upgraded to zsh 4.3.4 or later." else - $as_echo "$0: Please tell bug-autoconf@gnu.org about your system, + printf "%s\n" "$0: Please tell bug-autoconf@gnu.org about your system, $0: including any error possibly output before this $0: message. Then install a modern shell, or manually run $0: the script under such a shell if you do have one." @@ -291,6 +291,7 @@ as_fn_unset () } as_unset=as_fn_unset + # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. @@ -308,6 +309,14 @@ as_fn_exit () as_fn_set_status $1 exit $1 } # as_fn_exit +# as_fn_nop +# --------- +# Do nothing but, unlike ":", preserve the value of $?. +as_fn_nop () +{ + return $? +} +as_nop=as_fn_nop # as_fn_mkdir_p # ------------- @@ -322,7 +331,7 @@ as_fn_mkdir_p () as_dirs= while :; do case $as_dir in #( - *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( + *\'*) as_qdir=`printf "%s\n" "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" @@ -331,7 +340,7 @@ $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X"$as_dir" | +printf "%s\n" X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q @@ -370,12 +379,13 @@ as_fn_executable_p () # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. -if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : +if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null +then : eval 'as_fn_append () { eval $1+=\$2 }' -else +else $as_nop as_fn_append () { eval $1=\$$1\$2 @@ -387,18 +397,27 @@ fi # as_fn_append # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. -if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : +if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null +then : eval 'as_fn_arith () { as_val=$(( $* )) }' -else +else $as_nop as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` } fi # as_fn_arith +# as_fn_nop +# --------- +# Do nothing but, unlike ":", preserve the value of $?. +as_fn_nop () +{ + return $? +} +as_nop=as_fn_nop # as_fn_error STATUS ERROR [LINENO LOG_FD] # ---------------------------------------- @@ -410,9 +429,9 @@ as_fn_error () as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi - $as_echo "$as_me: error: $2" >&2 + printf "%s\n" "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error @@ -439,7 +458,7 @@ as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X/"$0" | +printf "%s\n" X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q @@ -483,7 +502,7 @@ as_cr_alnum=$as_cr_Letters$as_cr_digits s/-\n.*// ' >$as_me.lineno && chmod +x "$as_me.lineno" || - { $as_echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; } + { printf "%s\n" "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2; as_fn_exit 1; } # If we had to re-execute with $CONFIG_SHELL, we're ensured to have # already done that, so ensure we don't try to do so again and fall @@ -497,6 +516,10 @@ as_cr_alnum=$as_cr_Letters$as_cr_digits exit } + +# Determine whether it's possible to make 'echo' print without a newline. +# These variables are no longer used directly by Autoconf, but are AC_SUBSTed +# for compatibility with existing Makefiles. ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) @@ -510,6 +533,13 @@ case `echo -n x` in #((((( ECHO_N='-n';; esac +# For backward compatibility with old third-party macros, we provide +# the shell variables $as_echo and $as_echo_n. New code should use +# AS_ECHO(["message"]) and AS_ECHO_N(["message"]), respectively. +as_echo='printf %s\n' +as_echo_n='printf %s' + + rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file @@ -577,53 +607,54 @@ MAKEFLAGS= # Identity of this package. PACKAGE_NAME='seedtool-cli' PACKAGE_TARNAME='seedtool-cli' -PACKAGE_VERSION='0.10.2' -PACKAGE_STRING='seedtool-cli 0.10.2' +PACKAGE_VERSION='0.11.0' +PACKAGE_STRING='seedtool-cli 0.11.0' PACKAGE_BUGREPORT='' PACKAGE_URL='' ac_unique_file="src/seedtool.cpp" # Factoring default headers for most tests. ac_includes_default="\ -#include -#ifdef HAVE_SYS_TYPES_H -# include -#endif -#ifdef HAVE_SYS_STAT_H -# include +#include +#ifdef HAVE_STDIO_H +# include #endif -#ifdef STDC_HEADERS +#ifdef HAVE_STDLIB_H # include -# include -#else -# ifdef HAVE_STDLIB_H -# include -# endif #endif #ifdef HAVE_STRING_H -# if !defined STDC_HEADERS && defined HAVE_MEMORY_H -# include -# endif # include #endif -#ifdef HAVE_STRINGS_H -# include -#endif #ifdef HAVE_INTTYPES_H # include #endif #ifdef HAVE_STDINT_H # include #endif +#ifdef HAVE_STRINGS_H +# include +#endif +#ifdef HAVE_SYS_TYPES_H +# include +#endif +#ifdef HAVE_SYS_STAT_H +# include +#endif #ifdef HAVE_UNISTD_H # include #endif" +ac_header_c_list= ac_subst_vars='LTLIBOBJS LIBOBJS -EGREP -GREP -CPP +host_os +host_vendor +host_cpu +host +build_os +build_vendor +build_cpu +build SET_MAKE INSTALL_DATA INSTALL_SCRIPT @@ -691,8 +722,7 @@ LIBS CPPFLAGS CCC CC -CFLAGS -CPP' +CFLAGS' # Initialize some variables set by options. @@ -761,8 +791,6 @@ do *) ac_optarg=yes ;; esac - # Accept the important Cygnus configure options, so we can diagnose typos. - case $ac_dashdash$ac_option in --) ac_dashdash=yes ;; @@ -803,9 +831,9 @@ do ac_useropt=`expr "x$ac_option" : 'x-*disable-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && - as_fn_error $? "invalid feature name: $ac_useropt" + as_fn_error $? "invalid feature name: \`$ac_useropt'" ac_useropt_orig=$ac_useropt - ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` + ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" @@ -829,9 +857,9 @@ do ac_useropt=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && - as_fn_error $? "invalid feature name: $ac_useropt" + as_fn_error $? "invalid feature name: \`$ac_useropt'" ac_useropt_orig=$ac_useropt - ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` + ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "enable_$ac_useropt" @@ -1042,9 +1070,9 @@ do ac_useropt=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && - as_fn_error $? "invalid package name: $ac_useropt" + as_fn_error $? "invalid package name: \`$ac_useropt'" ac_useropt_orig=$ac_useropt - ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` + ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" @@ -1058,9 +1086,9 @@ do ac_useropt=`expr "x$ac_option" : 'x-*without-\(.*\)'` # Reject names that are not valid shell variable names. expr "x$ac_useropt" : ".*[^-+._$as_cr_alnum]" >/dev/null && - as_fn_error $? "invalid package name: $ac_useropt" + as_fn_error $? "invalid package name: \`$ac_useropt'" ac_useropt_orig=$ac_useropt - ac_useropt=`$as_echo "$ac_useropt" | sed 's/[-+.]/_/g'` + ac_useropt=`printf "%s\n" "$ac_useropt" | sed 's/[-+.]/_/g'` case $ac_user_opts in *" "with_$ac_useropt" @@ -1104,9 +1132,9 @@ Try \`$0 --help' for more information" *) # FIXME: should be removed in autoconf 3.0. - $as_echo "$as_me: WARNING: you should use --build, --host, --target" >&2 + printf "%s\n" "$as_me: WARNING: you should use --build, --host, --target" >&2 expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && - $as_echo "$as_me: WARNING: invalid host type: $ac_option" >&2 + printf "%s\n" "$as_me: WARNING: invalid host type: $ac_option" >&2 : "${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}" ;; @@ -1122,7 +1150,7 @@ if test -n "$ac_unrecognized_opts"; then case $enable_option_checking in no) ;; fatal) as_fn_error $? "unrecognized options: $ac_unrecognized_opts" ;; - *) $as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; + *) printf "%s\n" "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2 ;; esac fi @@ -1186,7 +1214,7 @@ $as_expr X"$as_myself" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_myself" : 'X\(//\)[^/]' \| \ X"$as_myself" : 'X\(//\)$' \| \ X"$as_myself" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X"$as_myself" | +printf "%s\n" X"$as_myself" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q @@ -1243,7 +1271,7 @@ if test "$ac_init_help" = "long"; then # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF -\`configure' configures seedtool-cli 0.10.2 to adapt to many kinds of systems. +\`configure' configures seedtool-cli 0.11.0 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... @@ -1300,12 +1328,16 @@ Fine tuning of the installation directories: _ACEOF cat <<\_ACEOF + +System types: + --build=BUILD configure for building on BUILD [guessed] + --host=HOST cross-compile to build programs to run on HOST [BUILD] _ACEOF fi if test -n "$ac_init_help"; then case $ac_init_help in - short | recursive ) echo "Configuration of seedtool-cli 0.10.2:";; + short | recursive ) echo "Configuration of seedtool-cli 0.11.0:";; esac cat <<\_ACEOF @@ -1319,7 +1351,6 @@ Some influential environment variables: you have headers in a nonstandard directory CC C compiler command CFLAGS C compiler flags - CPP C preprocessor Use these variables to override the choices made by `configure' or to help it to find libraries and programs with nonstandard names/locations. @@ -1340,9 +1371,9 @@ if test "$ac_init_help" = "recursive"; then case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) - ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` + ac_dir_suffix=/`printf "%s\n" "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. - ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` + ac_top_builddir_sub=`printf "%s\n" "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; @@ -1370,7 +1401,8 @@ esac ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix cd "$ac_dir" || { ac_status=$?; continue; } - # Check for guested configure. + # Check for configure.gnu first; this name is used for a wrapper for + # Metaconfig's "Configure" on case-insensitive file systems. if test -f "$ac_srcdir/configure.gnu"; then echo && $SHELL "$ac_srcdir/configure.gnu" --help=recursive @@ -1378,7 +1410,7 @@ ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix echo && $SHELL "$ac_srcdir/configure" --help=recursive else - $as_echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 + printf "%s\n" "$as_me: WARNING: no configuration information is in $ac_dir" >&2 fi || ac_status=$? cd "$ac_pwd" || { ac_status=$?; break; } done @@ -1387,10 +1419,10 @@ fi test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF -seedtool-cli configure 0.10.2 -generated by GNU Autoconf 2.69 +seedtool-cli configure 0.11.0 +generated by GNU Autoconf 2.71 -Copyright (C) 2012 Free Software Foundation, Inc. +Copyright (C) 2021 Free Software Foundation, Inc. This configure script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it. _ACEOF @@ -1407,14 +1439,14 @@ fi ac_fn_cxx_try_compile () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - rm -f conftest.$ac_objext + rm -f conftest.$ac_objext conftest.beam if { { ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_compile") 2>conftest.err ac_status=$? if test -s conftest.err; then @@ -1422,14 +1454,15 @@ $as_echo "$ac_try_echo"; } >&5 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { test -z "$ac_cxx_werror_flag" || test ! -s conftest.err - } && test -s conftest.$ac_objext; then : + } && test -s conftest.$ac_objext +then : ac_retval=0 -else - $as_echo "$as_me: failed program was:" >&5 +else $as_nop + printf "%s\n" "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 @@ -1445,14 +1478,14 @@ fi ac_fn_c_try_compile () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - rm -f conftest.$ac_objext + rm -f conftest.$ac_objext conftest.beam if { { ac_try="$ac_compile" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_compile") 2>conftest.err ac_status=$? if test -s conftest.err; then @@ -1460,14 +1493,15 @@ $as_echo "$ac_try_echo"; } >&5 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err - } && test -s conftest.$ac_objext; then : + } && test -s conftest.$ac_objext +then : ac_retval=0 -else - $as_echo "$as_me: failed program was:" >&5 +else $as_nop + printf "%s\n" "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 @@ -1483,14 +1517,14 @@ fi ac_fn_c_try_link () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - rm -f conftest.$ac_objext conftest$ac_exeext + rm -f conftest.$ac_objext conftest.beam conftest$ac_exeext if { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_link") 2>conftest.err ac_status=$? if test -s conftest.err; then @@ -1498,17 +1532,18 @@ $as_echo "$ac_try_echo"; } >&5 cat conftest.er1 >&5 mv -f conftest.er1 conftest.err fi - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { test -z "$ac_c_werror_flag" || test ! -s conftest.err } && test -s conftest$ac_exeext && { test "$cross_compiling" = yes || test -x conftest$ac_exeext - }; then : + } +then : ac_retval=0 -else - $as_echo "$as_me: failed program was:" >&5 +else $as_nop + printf "%s\n" "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 ac_retval=1 @@ -1523,172 +1558,6 @@ fi } # ac_fn_c_try_link -# ac_fn_c_try_cpp LINENO -# ---------------------- -# Try to preprocess conftest.$ac_ext, and return whether this succeeded. -ac_fn_c_try_cpp () -{ - as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - if { { ac_try="$ac_cpp conftest.$ac_ext" -case "(($ac_try" in - *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; - *) ac_try_echo=$ac_try;; -esac -eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 - (eval "$ac_cpp conftest.$ac_ext") 2>conftest.err - ac_status=$? - if test -s conftest.err; then - grep -v '^ *+' conftest.err >conftest.er1 - cat conftest.er1 >&5 - mv -f conftest.er1 conftest.err - fi - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; } > conftest.i && { - test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || - test ! -s conftest.err - }; then : - ac_retval=0 -else - $as_echo "$as_me: failed program was:" >&5 -sed 's/^/| /' conftest.$ac_ext >&5 - - ac_retval=1 -fi - eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno - as_fn_set_status $ac_retval - -} # ac_fn_c_try_cpp - -# ac_fn_c_check_header_mongrel LINENO HEADER VAR INCLUDES -# ------------------------------------------------------- -# Tests whether HEADER exists, giving a warning if it cannot be compiled using -# the include files in INCLUDES and setting the cache variable VAR -# accordingly. -ac_fn_c_check_header_mongrel () -{ - as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - if eval \${$3+:} false; then : - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 -$as_echo_n "checking for $2... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -fi -eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } -else - # Is the header compilable? -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 usability" >&5 -$as_echo_n "checking $2 usability... " >&6; } -cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -$4 -#include <$2> -_ACEOF -if ac_fn_c_try_compile "$LINENO"; then : - ac_header_compiler=yes -else - ac_header_compiler=no -fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_compiler" >&5 -$as_echo "$ac_header_compiler" >&6; } - -# Is the header present? -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking $2 presence" >&5 -$as_echo_n "checking $2 presence... " >&6; } -cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include <$2> -_ACEOF -if ac_fn_c_try_cpp "$LINENO"; then : - ac_header_preproc=yes -else - ac_header_preproc=no -fi -rm -f conftest.err conftest.i conftest.$ac_ext -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_header_preproc" >&5 -$as_echo "$ac_header_preproc" >&6; } - -# So? What about this header? -case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in #(( - yes:no: ) - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&5 -$as_echo "$as_me: WARNING: $2: accepted by the compiler, rejected by the preprocessor!" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5 -$as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;} - ;; - no:yes:* ) - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: present but cannot be compiled" >&5 -$as_echo "$as_me: WARNING: $2: present but cannot be compiled" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: check for missing prerequisite headers?" >&5 -$as_echo "$as_me: WARNING: $2: check for missing prerequisite headers?" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: see the Autoconf documentation" >&5 -$as_echo "$as_me: WARNING: $2: see the Autoconf documentation" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&5 -$as_echo "$as_me: WARNING: $2: section \"Present But Cannot Be Compiled\"" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $2: proceeding with the compiler's result" >&5 -$as_echo "$as_me: WARNING: $2: proceeding with the compiler's result" >&2;} - ;; -esac - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 -$as_echo_n "checking for $2... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else - eval "$3=\$ac_header_compiler" -fi -eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } -fi - eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno - -} # ac_fn_c_check_header_mongrel - -# ac_fn_c_try_run LINENO -# ---------------------- -# Try to link conftest.$ac_ext, and return whether this succeeded. Assumes -# that executables *can* be run. -ac_fn_c_try_run () -{ - as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - if { { ac_try="$ac_link" -case "(($ac_try" in - *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; - *) ac_try_echo=$ac_try;; -esac -eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 - (eval "$ac_link") 2>&5 - ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; } && { ac_try='./conftest$ac_exeext' - { { case "(($ac_try" in - *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; - *) ac_try_echo=$ac_try;; -esac -eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 - (eval "$ac_try") 2>&5 - ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; }; }; then : - ac_retval=0 -else - $as_echo "$as_me: program exited with status $ac_status" >&5 - $as_echo "$as_me: failed program was:" >&5 -sed 's/^/| /' conftest.$ac_ext >&5 - - ac_retval=$ac_status -fi - rm -rf conftest.dSYM conftest_ipa8_conftest.oo - eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno - as_fn_set_status $ac_retval - -} # ac_fn_c_try_run - # ac_fn_c_check_header_compile LINENO HEADER VAR INCLUDES # ------------------------------------------------------- # Tests whether HEADER exists and can be compiled using the include files in @@ -1696,26 +1565,28 @@ fi ac_fn_c_check_header_compile () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 -$as_echo_n "checking for $2... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 +printf %s "checking for $2... " >&6; } +if eval test \${$3+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 #include <$2> _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : eval "$3=yes" -else +else $as_nop eval "$3=no" fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 +printf "%s\n" "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_header_compile @@ -1727,17 +1598,18 @@ $as_echo "$ac_res" >&6; } ac_fn_c_check_type () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 -$as_echo_n "checking for $2... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 +printf %s "checking for $2... " >&6; } +if eval test \${$3+y} +then : + printf %s "(cached) " >&6 +else $as_nop eval "$3=no" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int -main () +main (void) { if (sizeof ($2)) return 0; @@ -1745,12 +1617,13 @@ if (sizeof ($2)) return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $4 int -main () +main (void) { if (sizeof (($2))) return 0; @@ -1758,18 +1631,19 @@ if (sizeof (($2))) return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : -else +else $as_nop eval "$3=yes" fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 +printf "%s\n" "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_type @@ -1781,11 +1655,12 @@ $as_echo "$ac_res" >&6; } ac_fn_c_find_uintX_t () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for uint$2_t" >&5 -$as_echo_n "checking for uint$2_t... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for uint$2_t" >&5 +printf %s "checking for uint$2_t... " >&6; } +if eval test \${$3+y} +then : + printf %s "(cached) " >&6 +else $as_nop eval "$3=no" # Order is important - never check a type that is potentially smaller # than half of the expected target width. @@ -1795,7 +1670,7 @@ else /* end confdefs.h. */ $ac_includes_default int -main () +main (void) { static int test_array [1 - 2 * !((($ac_type) -1 >> ($2 / 2 - 1)) >> ($2 / 2 - 1) == 3)]; test_array [0] = 0; @@ -1805,7 +1680,8 @@ return test_array [0]; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : case $ac_type in #( uint$2_t) : eval "$3=yes" ;; #( @@ -1813,17 +1689,18 @@ if ac_fn_c_try_compile "$LINENO"; then : eval "$3=\$ac_type" ;; esac fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext - if eval test \"x\$"$3"\" = x"no"; then : +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext + if eval test \"x\$"$3"\" = x"no" +then : -else +else $as_nop break fi done fi eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 +printf "%s\n" "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_find_uintX_t @@ -1835,11 +1712,12 @@ $as_echo "$ac_res" >&6; } ac_fn_c_find_intX_t () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for int$2_t" >&5 -$as_echo_n "checking for int$2_t... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for int$2_t" >&5 +printf %s "checking for int$2_t... " >&6; } +if eval test \${$3+y} +then : + printf %s "(cached) " >&6 +else $as_nop eval "$3=no" # Order is important - never check a type that is potentially smaller # than half of the expected target width. @@ -1850,7 +1728,7 @@ else $ac_includes_default enum { N = $2 / 2 - 1 }; int -main () +main (void) { static int test_array [1 - 2 * !(0 < ($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 1))]; test_array [0] = 0; @@ -1860,13 +1738,14 @@ return test_array [0]; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ $ac_includes_default enum { N = $2 / 2 - 1 }; int -main () +main (void) { static int test_array [1 - 2 * !(($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 1) < ($ac_type) ((((($ac_type) 1 << N) << N) - 1) * 2 + 2))]; @@ -1877,9 +1756,10 @@ return test_array [0]; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : -else +else $as_nop case $ac_type in #( int$2_t) : eval "$3=yes" ;; #( @@ -1887,34 +1767,79 @@ else eval "$3=\$ac_type" ;; esac fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext - if eval test \"x\$"$3"\" = x"no"; then : +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext + if eval test \"x\$"$3"\" = x"no" +then : -else +else $as_nop break fi done fi eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 +printf "%s\n" "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_find_intX_t +# ac_fn_c_try_run LINENO +# ---------------------- +# Try to run conftest.$ac_ext, and return whether this succeeded. Assumes that +# executables *can* be run. +ac_fn_c_try_run () +{ + as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack + if { { ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" +printf "%s\n" "$ac_try_echo"; } >&5 + (eval "$ac_link") 2>&5 + ac_status=$? + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + test $ac_status = 0; } && { ac_try='./conftest$ac_exeext' + { { case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" +printf "%s\n" "$ac_try_echo"; } >&5 + (eval "$ac_try") 2>&5 + ac_status=$? + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + test $ac_status = 0; }; } +then : + ac_retval=0 +else $as_nop + printf "%s\n" "$as_me: program exited with status $ac_status" >&5 + printf "%s\n" "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_retval=$ac_status +fi + rm -rf conftest.dSYM conftest_ipa8_conftest.oo + eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno + as_fn_set_status $ac_retval + +} # ac_fn_c_try_run + # ac_fn_c_check_func LINENO FUNC VAR # ---------------------------------- # Tests whether FUNC exists, setting the cache variable VAR accordingly ac_fn_c_check_func () { as_lineno=${as_lineno-"$1"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - { $as_echo "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 -$as_echo_n "checking for $2... " >&6; } -if eval \${$3+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $2" >&5 +printf %s "checking for $2... " >&6; } +if eval test \${$3+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ /* Define $2 to an innocuous variant, in case declares $2. @@ -1922,16 +1847,9 @@ else #define $2 innocuous_$2 /* System header to define __stub macros and hopefully few prototypes, - which can conflict with char $2 (); below. - Prefer to if __STDC__ is defined, since - exists even on freestanding compilers. */ - -#ifdef __STDC__ -# include -#else -# include -#endif + which can conflict with char $2 (); below. */ +#include #undef $2 /* Override any GCC internal prototype to avoid an error. @@ -1949,35 +1867,56 @@ choke me #endif int -main () +main (void) { return $2 (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : eval "$3=yes" -else +else $as_nop eval "$3=no" fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext fi eval ac_res=\$$3 - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 -$as_echo "$ac_res" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_res" >&5 +printf "%s\n" "$ac_res" >&6; } eval $as_lineno_stack; ${as_lineno_stack:+:} unset as_lineno } # ac_fn_c_check_func +ac_configure_args_raw= +for ac_arg +do + case $ac_arg in + *\'*) + ac_arg=`printf "%s\n" "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; + esac + as_fn_append ac_configure_args_raw " '$ac_arg'" +done + +case $ac_configure_args_raw in + *$as_nl*) + ac_safe_unquote= ;; + *) + ac_unsafe_z='|&;<>()$`\\"*?[ '' ' # This string ends in space, tab. + ac_unsafe_a="$ac_unsafe_z#~" + ac_safe_unquote="s/ '\\([^$ac_unsafe_a][^$ac_unsafe_z]*\\)'/ \\1/g" + ac_configure_args_raw=` printf "%s\n" "$ac_configure_args_raw" | sed "$ac_safe_unquote"`;; +esac + cat >config.log <<_ACEOF This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. -It was created by seedtool-cli $as_me 0.10.2, which was -generated by GNU Autoconf 2.69. Invocation command line was +It was created by seedtool-cli $as_me 0.11.0, which was +generated by GNU Autoconf 2.71. Invocation command line was - $ $0 $@ + $ $0$ac_configure_args_raw _ACEOF exec 5>>config.log @@ -2010,8 +1949,12 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - $as_echo "PATH: $as_dir" + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + printf "%s\n" "PATH: $as_dir" done IFS=$as_save_IFS @@ -2046,7 +1989,7 @@ do | -silent | --silent | --silen | --sile | --sil) continue ;; *\'*) - ac_arg=`$as_echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; + ac_arg=`printf "%s\n" "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; esac case $ac_pass in 1) as_fn_append ac_configure_args0 " '$ac_arg'" ;; @@ -2081,11 +2024,13 @@ done # WARNING: Use '\'' to represent an apostrophe within the trap. # WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. trap 'exit_status=$? + # Sanitize IFS. + IFS=" "" $as_nl" # Save into config.log some information that might help in debugging. { echo - $as_echo "## ---------------- ## + printf "%s\n" "## ---------------- ## ## Cache variables. ## ## ---------------- ##" echo @@ -2096,8 +2041,8 @@ trap 'exit_status=$? case $ac_val in #( *${as_nl}*) case $ac_var in #( - *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 -$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; + *_cv_*) { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 +printf "%s\n" "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( @@ -2121,7 +2066,7 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; ) echo - $as_echo "## ----------------- ## + printf "%s\n" "## ----------------- ## ## Output variables. ## ## ----------------- ##" echo @@ -2129,14 +2074,14 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; do eval ac_val=\$$ac_var case $ac_val in - *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; + *\'\''*) ac_val=`printf "%s\n" "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac - $as_echo "$ac_var='\''$ac_val'\''" + printf "%s\n" "$ac_var='\''$ac_val'\''" done | sort echo if test -n "$ac_subst_files"; then - $as_echo "## ------------------- ## + printf "%s\n" "## ------------------- ## ## File substitutions. ## ## ------------------- ##" echo @@ -2144,15 +2089,15 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; do eval ac_val=\$$ac_var case $ac_val in - *\'\''*) ac_val=`$as_echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; + *\'\''*) ac_val=`printf "%s\n" "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; esac - $as_echo "$ac_var='\''$ac_val'\''" + printf "%s\n" "$ac_var='\''$ac_val'\''" done | sort echo fi if test -s confdefs.h; then - $as_echo "## ----------- ## + printf "%s\n" "## ----------- ## ## confdefs.h. ## ## ----------- ##" echo @@ -2160,8 +2105,8 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; echo fi test "$ac_signal" != 0 && - $as_echo "$as_me: caught signal $ac_signal" - $as_echo "$as_me: exit $exit_status" + printf "%s\n" "$as_me: caught signal $ac_signal" + printf "%s\n" "$as_me: exit $exit_status" } >&5 rm -f core *.core core.conftest.* && rm -f -r conftest* confdefs* conf$$* $ac_clean_files && @@ -2175,63 +2120,48 @@ ac_signal=0 # confdefs.h avoids OS command line length limits that DEFS can exceed. rm -f -r conftest* confdefs.h -$as_echo "/* confdefs.h */" > confdefs.h +printf "%s\n" "/* confdefs.h */" > confdefs.h # Predefined preprocessor variables. -cat >>confdefs.h <<_ACEOF -#define PACKAGE_NAME "$PACKAGE_NAME" -_ACEOF +printf "%s\n" "#define PACKAGE_NAME \"$PACKAGE_NAME\"" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define PACKAGE_TARNAME "$PACKAGE_TARNAME" -_ACEOF +printf "%s\n" "#define PACKAGE_TARNAME \"$PACKAGE_TARNAME\"" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define PACKAGE_VERSION "$PACKAGE_VERSION" -_ACEOF +printf "%s\n" "#define PACKAGE_VERSION \"$PACKAGE_VERSION\"" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define PACKAGE_STRING "$PACKAGE_STRING" -_ACEOF +printf "%s\n" "#define PACKAGE_STRING \"$PACKAGE_STRING\"" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" -_ACEOF +printf "%s\n" "#define PACKAGE_BUGREPORT \"$PACKAGE_BUGREPORT\"" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define PACKAGE_URL "$PACKAGE_URL" -_ACEOF +printf "%s\n" "#define PACKAGE_URL \"$PACKAGE_URL\"" >>confdefs.h # Let the site file select an alternate cache file if it wants to. # Prefer an explicitly selected file to automatically selected ones. -ac_site_file1=NONE -ac_site_file2=NONE if test -n "$CONFIG_SITE"; then - # We do not want a PATH search for config.site. - case $CONFIG_SITE in #(( - -*) ac_site_file1=./$CONFIG_SITE;; - */*) ac_site_file1=$CONFIG_SITE;; - *) ac_site_file1=./$CONFIG_SITE;; - esac + ac_site_files="$CONFIG_SITE" elif test "x$prefix" != xNONE; then - ac_site_file1=$prefix/share/config.site - ac_site_file2=$prefix/etc/config.site + ac_site_files="$prefix/share/config.site $prefix/etc/config.site" else - ac_site_file1=$ac_default_prefix/share/config.site - ac_site_file2=$ac_default_prefix/etc/config.site + ac_site_files="$ac_default_prefix/share/config.site $ac_default_prefix/etc/config.site" fi -for ac_site_file in "$ac_site_file1" "$ac_site_file2" + +for ac_site_file in $ac_site_files do - test "x$ac_site_file" = xNONE && continue - if test /dev/null != "$ac_site_file" && test -r "$ac_site_file"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5 -$as_echo "$as_me: loading site script $ac_site_file" >&6;} + case $ac_site_file in #( + */*) : + ;; #( + *) : + ac_site_file=./$ac_site_file ;; +esac + if test -f "$ac_site_file" && test -r "$ac_site_file"; then + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: loading site script $ac_site_file" >&5 +printf "%s\n" "$as_me: loading site script $ac_site_file" >&6;} sed 's/^/| /' "$ac_site_file" >&5 . "$ac_site_file" \ - || { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} + || { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "failed to load site script $ac_site_file See \`config.log' for more details" "$LINENO" 5; } fi @@ -2241,61 +2171,692 @@ if test -r "$cache_file"; then # Some versions of bash will fail to source /dev/null (special files # actually), so we avoid doing that. DJGPP emulates it as a regular file. if test /dev/null != "$cache_file" && test -f "$cache_file"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5 -$as_echo "$as_me: loading cache $cache_file" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: loading cache $cache_file" >&5 +printf "%s\n" "$as_me: loading cache $cache_file" >&6;} case $cache_file in [\\/]* | ?:[\\/]* ) . "$cache_file";; *) . "./$cache_file";; esac fi else - { $as_echo "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5 -$as_echo "$as_me: creating cache $cache_file" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating cache $cache_file" >&5 +printf "%s\n" "$as_me: creating cache $cache_file" >&6;} >$cache_file fi -# Check that the precious variables saved in the cache have kept the same -# value. -ac_cache_corrupted=false -for ac_var in $ac_precious_vars; do - eval ac_old_set=\$ac_cv_env_${ac_var}_set - eval ac_new_set=\$ac_env_${ac_var}_set - eval ac_old_val=\$ac_cv_env_${ac_var}_value - eval ac_new_val=\$ac_env_${ac_var}_value - case $ac_old_set,$ac_new_set in - set,) - { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 -$as_echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} - ac_cache_corrupted=: ;; - ,set) - { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5 -$as_echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} - ac_cache_corrupted=: ;; - ,);; - *) - if test "x$ac_old_val" != "x$ac_new_val"; then - # differences in whitespace do not lead to failure. - ac_old_val_w=`echo x $ac_old_val` - ac_new_val_w=`echo x $ac_new_val` - if test "$ac_old_val_w" != "$ac_new_val_w"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5 -$as_echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} - ac_cache_corrupted=: - else - { $as_echo "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 -$as_echo "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} - eval $ac_var=\$ac_old_val +# Test code for whether the C++ compiler supports C++98 (global declarations) +ac_cxx_conftest_cxx98_globals=' +// Does the compiler advertise C++98 conformance? +#if !defined __cplusplus || __cplusplus < 199711L +# error "Compiler does not advertise C++98 conformance" +#endif + +// These inclusions are to reject old compilers that +// lack the unsuffixed header files. +#include +#include + +// and are *not* freestanding headers in C++98. +extern void assert (int); +namespace std { + extern int strcmp (const char *, const char *); +} + +// Namespaces, exceptions, and templates were all added after "C++ 2.0". +using std::exception; +using std::strcmp; + +namespace { + +void test_exception_syntax() +{ + try { + throw "test"; + } catch (const char *s) { + // Extra parentheses suppress a warning when building autoconf itself, + // due to lint rules shared with more typical C programs. + assert (!(strcmp) (s, "test")); + } +} + +template struct test_template +{ + T const val; + explicit test_template(T t) : val(t) {} + template T add(U u) { return static_cast(u) + val; } +}; + +} // anonymous namespace +' + +# Test code for whether the C++ compiler supports C++98 (body of main) +ac_cxx_conftest_cxx98_main=' + assert (argc); + assert (! argv[0]); +{ + test_exception_syntax (); + test_template tt (2.0); + assert (tt.add (4) == 6.0); + assert (true && !false); +} +' + +# Test code for whether the C++ compiler supports C++11 (global declarations) +ac_cxx_conftest_cxx11_globals=' +// Does the compiler advertise C++ 2011 conformance? +#if !defined __cplusplus || __cplusplus < 201103L +# error "Compiler does not advertise C++11 conformance" +#endif + +namespace cxx11test +{ + constexpr int get_val() { return 20; } + + struct testinit + { + int i; + double d; + }; + + class delegate + { + public: + delegate(int n) : n(n) {} + delegate(): delegate(2354) {} + + virtual int getval() { return this->n; }; + protected: + int n; + }; + + class overridden : public delegate + { + public: + overridden(int n): delegate(n) {} + virtual int getval() override final { return this->n * 2; } + }; + + class nocopy + { + public: + nocopy(int i): i(i) {} + nocopy() = default; + nocopy(const nocopy&) = delete; + nocopy & operator=(const nocopy&) = delete; + private: + int i; + }; + + // for testing lambda expressions + template Ret eval(Fn f, Ret v) + { + return f(v); + } + + // for testing variadic templates and trailing return types + template auto sum(V first) -> V + { + return first; + } + template auto sum(V first, Args... rest) -> V + { + return first + sum(rest...); + } +} +' + +# Test code for whether the C++ compiler supports C++11 (body of main) +ac_cxx_conftest_cxx11_main=' +{ + // Test auto and decltype + auto a1 = 6538; + auto a2 = 48573953.4; + auto a3 = "String literal"; + + int total = 0; + for (auto i = a3; *i; ++i) { total += *i; } + + decltype(a2) a4 = 34895.034; +} +{ + // Test constexpr + short sa[cxx11test::get_val()] = { 0 }; +} +{ + // Test initializer lists + cxx11test::testinit il = { 4323, 435234.23544 }; +} +{ + // Test range-based for + int array[] = {9, 7, 13, 15, 4, 18, 12, 10, 5, 3, + 14, 19, 17, 8, 6, 20, 16, 2, 11, 1}; + for (auto &x : array) { x += 23; } +} +{ + // Test lambda expressions + using cxx11test::eval; + assert (eval ([](int x) { return x*2; }, 21) == 42); + double d = 2.0; + assert (eval ([&](double x) { return d += x; }, 3.0) == 5.0); + assert (d == 5.0); + assert (eval ([=](double x) mutable { return d += x; }, 4.0) == 9.0); + assert (d == 5.0); +} +{ + // Test use of variadic templates + using cxx11test::sum; + auto a = sum(1); + auto b = sum(1, 2); + auto c = sum(1.0, 2.0, 3.0); +} +{ + // Test constructor delegation + cxx11test::delegate d1; + cxx11test::delegate d2(); + cxx11test::delegate d3(45); +} +{ + // Test override and final + cxx11test::overridden o1(55464); +} +{ + // Test nullptr + char *c = nullptr; +} +{ + // Test template brackets + test_template<::test_template> v(test_template(12)); +} +{ + // Unicode literals + char const *utf8 = u8"UTF-8 string \u2500"; + char16_t const *utf16 = u"UTF-8 string \u2500"; + char32_t const *utf32 = U"UTF-32 string \u2500"; +} +' + +# Test code for whether the C compiler supports C++11 (complete). +ac_cxx_conftest_cxx11_program="${ac_cxx_conftest_cxx98_globals} +${ac_cxx_conftest_cxx11_globals} + +int +main (int argc, char **argv) +{ + int ok = 0; + ${ac_cxx_conftest_cxx98_main} + ${ac_cxx_conftest_cxx11_main} + return ok; +} +" + +# Test code for whether the C compiler supports C++98 (complete). +ac_cxx_conftest_cxx98_program="${ac_cxx_conftest_cxx98_globals} +int +main (int argc, char **argv) +{ + int ok = 0; + ${ac_cxx_conftest_cxx98_main} + return ok; +} +" + +# Test code for whether the C compiler supports C89 (global declarations) +ac_c_conftest_c89_globals=' +/* Does the compiler advertise C89 conformance? + Do not test the value of __STDC__, because some compilers set it to 0 + while being otherwise adequately conformant. */ +#if !defined __STDC__ +# error "Compiler does not advertise C89 conformance" +#endif + +#include +#include +struct stat; +/* Most of the following tests are stolen from RCS 5.7 src/conf.sh. */ +struct buf { int x; }; +struct buf * (*rcsopen) (struct buf *, struct stat *, int); +static char *e (p, i) + char **p; + int i; +{ + return p[i]; +} +static char *f (char * (*g) (char **, int), char **p, ...) +{ + char *s; + va_list v; + va_start (v,p); + s = g (p, va_arg (v,int)); + va_end (v); + return s; +} + +/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has + function prototypes and stuff, but not \xHH hex character constants. + These do not provoke an error unfortunately, instead are silently treated + as an "x". The following induces an error, until -std is added to get + proper ANSI mode. Curiously \x00 != x always comes out true, for an + array size at least. It is necessary to write \x00 == 0 to get something + that is true only with -std. */ +int osf4_cc_array ['\''\x00'\'' == 0 ? 1 : -1]; + +/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters + inside strings and character constants. */ +#define FOO(x) '\''x'\'' +int xlc6_cc_array[FOO(a) == '\''x'\'' ? 1 : -1]; + +int test (int i, double x); +struct s1 {int (*f) (int a);}; +struct s2 {int (*f) (double a);}; +int pairnames (int, char **, int *(*)(struct buf *, struct stat *, int), + int, int);' + +# Test code for whether the C compiler supports C89 (body of main). +ac_c_conftest_c89_main=' +ok |= (argc == 0 || f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]); +' + +# Test code for whether the C compiler supports C99 (global declarations) +ac_c_conftest_c99_globals=' +// Does the compiler advertise C99 conformance? +#if !defined __STDC_VERSION__ || __STDC_VERSION__ < 199901L +# error "Compiler does not advertise C99 conformance" +#endif + +#include +extern int puts (const char *); +extern int printf (const char *, ...); +extern int dprintf (int, const char *, ...); +extern void *malloc (size_t); + +// Check varargs macros. These examples are taken from C99 6.10.3.5. +// dprintf is used instead of fprintf to avoid needing to declare +// FILE and stderr. +#define debug(...) dprintf (2, __VA_ARGS__) +#define showlist(...) puts (#__VA_ARGS__) +#define report(test,...) ((test) ? puts (#test) : printf (__VA_ARGS__)) +static void +test_varargs_macros (void) +{ + int x = 1234; + int y = 5678; + debug ("Flag"); + debug ("X = %d\n", x); + showlist (The first, second, and third items.); + report (x>y, "x is %d but y is %d", x, y); +} + +// Check long long types. +#define BIG64 18446744073709551615ull +#define BIG32 4294967295ul +#define BIG_OK (BIG64 / BIG32 == 4294967297ull && BIG64 % BIG32 == 0) +#if !BIG_OK + #error "your preprocessor is broken" +#endif +#if BIG_OK +#else + #error "your preprocessor is broken" +#endif +static long long int bignum = -9223372036854775807LL; +static unsigned long long int ubignum = BIG64; + +struct incomplete_array +{ + int datasize; + double data[]; +}; + +struct named_init { + int number; + const wchar_t *name; + double average; +}; + +typedef const char *ccp; + +static inline int +test_restrict (ccp restrict text) +{ + // See if C++-style comments work. + // Iterate through items via the restricted pointer. + // Also check for declarations in for loops. + for (unsigned int i = 0; *(text+i) != '\''\0'\''; ++i) + continue; + return 0; +} + +// Check varargs and va_copy. +static bool +test_varargs (const char *format, ...) +{ + va_list args; + va_start (args, format); + va_list args_copy; + va_copy (args_copy, args); + + const char *str = ""; + int number = 0; + float fnumber = 0; + + while (*format) + { + switch (*format++) + { + case '\''s'\'': // string + str = va_arg (args_copy, const char *); + break; + case '\''d'\'': // int + number = va_arg (args_copy, int); + break; + case '\''f'\'': // float + fnumber = va_arg (args_copy, double); + break; + default: + break; + } + } + va_end (args_copy); + va_end (args); + + return *str && number && fnumber; +} +' + +# Test code for whether the C compiler supports C99 (body of main). +ac_c_conftest_c99_main=' + // Check bool. + _Bool success = false; + success |= (argc != 0); + + // Check restrict. + if (test_restrict ("String literal") == 0) + success = true; + char *restrict newvar = "Another string"; + + // Check varargs. + success &= test_varargs ("s, d'\'' f .", "string", 65, 34.234); + test_varargs_macros (); + + // Check flexible array members. + struct incomplete_array *ia = + malloc (sizeof (struct incomplete_array) + (sizeof (double) * 10)); + ia->datasize = 10; + for (int i = 0; i < ia->datasize; ++i) + ia->data[i] = i * 1.234; + + // Check named initializers. + struct named_init ni = { + .number = 34, + .name = L"Test wide string", + .average = 543.34343, + }; + + ni.number = 58; + + int dynamic_array[ni.number]; + dynamic_array[0] = argv[0][0]; + dynamic_array[ni.number - 1] = 543; + + // work around unused variable warnings + ok |= (!success || bignum == 0LL || ubignum == 0uLL || newvar[0] == '\''x'\'' + || dynamic_array[ni.number - 1] != 543); +' + +# Test code for whether the C compiler supports C11 (global declarations) +ac_c_conftest_c11_globals=' +// Does the compiler advertise C11 conformance? +#if !defined __STDC_VERSION__ || __STDC_VERSION__ < 201112L +# error "Compiler does not advertise C11 conformance" +#endif + +// Check _Alignas. +char _Alignas (double) aligned_as_double; +char _Alignas (0) no_special_alignment; +extern char aligned_as_int; +char _Alignas (0) _Alignas (int) aligned_as_int; + +// Check _Alignof. +enum +{ + int_alignment = _Alignof (int), + int_array_alignment = _Alignof (int[100]), + char_alignment = _Alignof (char) +}; +_Static_assert (0 < -_Alignof (int), "_Alignof is signed"); + +// Check _Noreturn. +int _Noreturn does_not_return (void) { for (;;) continue; } + +// Check _Static_assert. +struct test_static_assert +{ + int x; + _Static_assert (sizeof (int) <= sizeof (long int), + "_Static_assert does not work in struct"); + long int y; +}; + +// Check UTF-8 literals. +#define u8 syntax error! +char const utf8_literal[] = u8"happens to be ASCII" "another string"; + +// Check duplicate typedefs. +typedef long *long_ptr; +typedef long int *long_ptr; +typedef long_ptr long_ptr; + +// Anonymous structures and unions -- taken from C11 6.7.2.1 Example 1. +struct anonymous +{ + union { + struct { int i; int j; }; + struct { int k; long int l; } w; + }; + int m; +} v1; +' + +# Test code for whether the C compiler supports C11 (body of main). +ac_c_conftest_c11_main=' + _Static_assert ((offsetof (struct anonymous, i) + == offsetof (struct anonymous, w.k)), + "Anonymous union alignment botch"); + v1.i = 2; + v1.w.k = 5; + ok |= v1.i != 5; +' + +# Test code for whether the C compiler supports C11 (complete). +ac_c_conftest_c11_program="${ac_c_conftest_c89_globals} +${ac_c_conftest_c99_globals} +${ac_c_conftest_c11_globals} + +int +main (int argc, char **argv) +{ + int ok = 0; + ${ac_c_conftest_c89_main} + ${ac_c_conftest_c99_main} + ${ac_c_conftest_c11_main} + return ok; +} +" + +# Test code for whether the C compiler supports C99 (complete). +ac_c_conftest_c99_program="${ac_c_conftest_c89_globals} +${ac_c_conftest_c99_globals} + +int +main (int argc, char **argv) +{ + int ok = 0; + ${ac_c_conftest_c89_main} + ${ac_c_conftest_c99_main} + return ok; +} +" + +# Test code for whether the C compiler supports C89 (complete). +ac_c_conftest_c89_program="${ac_c_conftest_c89_globals} + +int +main (int argc, char **argv) +{ + int ok = 0; + ${ac_c_conftest_c89_main} + return ok; +} +" + +as_fn_append ac_header_c_list " stdio.h stdio_h HAVE_STDIO_H" +as_fn_append ac_header_c_list " stdlib.h stdlib_h HAVE_STDLIB_H" +as_fn_append ac_header_c_list " string.h string_h HAVE_STRING_H" +as_fn_append ac_header_c_list " inttypes.h inttypes_h HAVE_INTTYPES_H" +as_fn_append ac_header_c_list " stdint.h stdint_h HAVE_STDINT_H" +as_fn_append ac_header_c_list " strings.h strings_h HAVE_STRINGS_H" +as_fn_append ac_header_c_list " sys/stat.h sys_stat_h HAVE_SYS_STAT_H" +as_fn_append ac_header_c_list " sys/types.h sys_types_h HAVE_SYS_TYPES_H" +as_fn_append ac_header_c_list " unistd.h unistd_h HAVE_UNISTD_H" + +# Auxiliary files required by this configure script. +ac_aux_files="config.guess config.sub install-sh" + +# Locations in which to look for auxiliary files. +ac_aux_dir_candidates="${srcdir}/build-aux" + +# Search for a directory containing all of the required auxiliary files, +# $ac_aux_files, from the $PATH-style list $ac_aux_dir_candidates. +# If we don't find one directory that contains all the files we need, +# we report the set of missing files from the *first* directory in +# $ac_aux_dir_candidates and give up. +ac_missing_aux_files="" +ac_first_candidate=: +printf "%s\n" "$as_me:${as_lineno-$LINENO}: looking for aux files: $ac_aux_files" >&5 +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +as_found=false +for as_dir in $ac_aux_dir_candidates +do + IFS=$as_save_IFS + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + as_found=: + + printf "%s\n" "$as_me:${as_lineno-$LINENO}: trying $as_dir" >&5 + ac_aux_dir_found=yes + ac_install_sh= + for ac_aux in $ac_aux_files + do + # As a special case, if "install-sh" is required, that requirement + # can be satisfied by any of "install-sh", "install.sh", or "shtool", + # and $ac_install_sh is set appropriately for whichever one is found. + if test x"$ac_aux" = x"install-sh" + then + if test -f "${as_dir}install-sh"; then + printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}install-sh found" >&5 + ac_install_sh="${as_dir}install-sh -c" + elif test -f "${as_dir}install.sh"; then + printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}install.sh found" >&5 + ac_install_sh="${as_dir}install.sh -c" + elif test -f "${as_dir}shtool"; then + printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}shtool found" >&5 + ac_install_sh="${as_dir}shtool install -c" + else + ac_aux_dir_found=no + if $ac_first_candidate; then + ac_missing_aux_files="${ac_missing_aux_files} install-sh" + else + break + fi + fi + else + if test -f "${as_dir}${ac_aux}"; then + printf "%s\n" "$as_me:${as_lineno-$LINENO}: ${as_dir}${ac_aux} found" >&5 + else + ac_aux_dir_found=no + if $ac_first_candidate; then + ac_missing_aux_files="${ac_missing_aux_files} ${ac_aux}" + else + break + fi + fi + fi + done + if test "$ac_aux_dir_found" = yes; then + ac_aux_dir="$as_dir" + break + fi + ac_first_candidate=false + + as_found=false +done +IFS=$as_save_IFS +if $as_found +then : + +else $as_nop + as_fn_error $? "cannot find required auxiliary files:$ac_missing_aux_files" "$LINENO" 5 +fi + + +# These three variables are undocumented and unsupported, +# and are intended to be withdrawn in a future Autoconf release. +# They can cause serious problems if a builder's source tree is in a directory +# whose full name contains unusual characters. +if test -f "${ac_aux_dir}config.guess"; then + ac_config_guess="$SHELL ${ac_aux_dir}config.guess" +fi +if test -f "${ac_aux_dir}config.sub"; then + ac_config_sub="$SHELL ${ac_aux_dir}config.sub" +fi +if test -f "$ac_aux_dir/configure"; then + ac_configure="$SHELL ${ac_aux_dir}configure" +fi + +# Check that the precious variables saved in the cache have kept the same +# value. +ac_cache_corrupted=false +for ac_var in $ac_precious_vars; do + eval ac_old_set=\$ac_cv_env_${ac_var}_set + eval ac_new_set=\$ac_env_${ac_var}_set + eval ac_old_val=\$ac_cv_env_${ac_var}_value + eval ac_new_val=\$ac_env_${ac_var}_value + case $ac_old_set,$ac_new_set in + set,) + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 +printf "%s\n" "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} + ac_cache_corrupted=: ;; + ,set) + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' was not set in the previous run" >&5 +printf "%s\n" "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} + ac_cache_corrupted=: ;; + ,);; + *) + if test "x$ac_old_val" != "x$ac_new_val"; then + # differences in whitespace do not lead to failure. + ac_old_val_w=`echo x $ac_old_val` + ac_new_val_w=`echo x $ac_new_val` + if test "$ac_old_val_w" != "$ac_new_val_w"; then + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: \`$ac_var' has changed since the previous run:" >&5 +printf "%s\n" "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} + ac_cache_corrupted=: + else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&5 +printf "%s\n" "$as_me: warning: ignoring whitespace changes in \`$ac_var' since the previous run:" >&2;} + eval $ac_var=\$ac_old_val fi - { $as_echo "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5 -$as_echo "$as_me: former value: \`$ac_old_val'" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5 -$as_echo "$as_me: current value: \`$ac_new_val'" >&2;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: former value: \`$ac_old_val'" >&5 +printf "%s\n" "$as_me: former value: \`$ac_old_val'" >&2;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: current value: \`$ac_new_val'" >&5 +printf "%s\n" "$as_me: current value: \`$ac_new_val'" >&2;} fi;; esac # Pass precious variables to config.status. if test "$ac_new_set" = set; then case $ac_new_val in - *\'*) ac_arg=$ac_var=`$as_echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; + *\'*) ac_arg=$ac_var=`printf "%s\n" "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; *) ac_arg=$ac_var=$ac_new_val ;; esac case " $ac_configure_args " in @@ -2305,11 +2866,12 @@ $as_echo "$as_me: current value: \`$ac_new_val'" >&2;} fi done if $ac_cache_corrupted; then - { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} - { $as_echo "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5 -$as_echo "$as_me: error: changes in the environment can compromise the build" >&2;} - as_fn_error $? "run \`make distclean' and/or \`rm $cache_file' and start over" "$LINENO" 5 + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: changes in the environment can compromise the build" >&5 +printf "%s\n" "$as_me: error: changes in the environment can compromise the build" >&2;} + as_fn_error $? "run \`${MAKE-make} distclean' and/or \`rm $cache_file' + and start over" "$LINENO" 5 fi ## -------------------- ## ## Main body of script. ## @@ -2326,7 +2888,14 @@ ac_compiler_gnu=$ac_cv_c_compiler_gnu ac_config_headers="$ac_config_headers src/config.h" + # Checks for programs. + + + + + + ac_ext=cpp ac_cpp='$CXXCPP $CPPFLAGS' ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' @@ -2337,15 +2906,16 @@ if test -z "$CXX"; then CXX=$CCC else if test -n "$ac_tool_prefix"; then - for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC + for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC clang++ do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_CXX+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CXX+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$CXX"; then ac_cv_prog_CXX="$CXX" # Let the user override the test. else @@ -2353,11 +2923,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_CXX="$ac_tool_prefix$ac_prog" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -2368,11 +2942,11 @@ fi fi CXX=$ac_cv_prog_CXX if test -n "$CXX"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CXX" >&5 -$as_echo "$CXX" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CXX" >&5 +printf "%s\n" "$CXX" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -2381,15 +2955,16 @@ fi fi if test -z "$CXX"; then ac_ct_CXX=$CXX - for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC + for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC clang++ do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_ac_ct_CXX+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_ac_ct_CXX+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$ac_ct_CXX"; then ac_cv_prog_ac_ct_CXX="$ac_ct_CXX" # Let the user override the test. else @@ -2397,11 +2972,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CXX="$ac_prog" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -2412,11 +2991,11 @@ fi fi ac_ct_CXX=$ac_cv_prog_ac_ct_CXX if test -n "$ac_ct_CXX"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CXX" >&5 -$as_echo "$ac_ct_CXX" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CXX" >&5 +printf "%s\n" "$ac_ct_CXX" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -2428,8 +3007,8 @@ done else case $cross_compiling:$ac_tool_warned in yes:) -{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 -$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 +printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CXX=$ac_ct_CXX @@ -2439,7 +3018,7 @@ fi fi fi # Provide some information about the compiler. -$as_echo "$as_me:${as_lineno-$LINENO}: checking for C++ compiler version" >&5 +printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C++ compiler version" >&5 set X $ac_compile ac_compiler=$2 for ac_option in --version -v -V -qversion; do @@ -2449,7 +3028,7 @@ case "(($ac_try" in *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_compiler $ac_option >&5") 2>conftest.err ac_status=$? if test -s conftest.err; then @@ -2459,7 +3038,7 @@ $as_echo "$ac_try_echo"; } >&5 cat conftest.er1 >&5 fi rm -f conftest.er1 conftest.err - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } done @@ -2467,7 +3046,7 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; @@ -2479,9 +3058,9 @@ ac_clean_files="$ac_clean_files a.out a.out.dSYM a.exe b.out" # Try to create an executable without -o first, disregard a.out. # It will help us diagnose broken compilers, and finding out an intuition # of exeext. -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether the C++ compiler works" >&5 -$as_echo_n "checking whether the C++ compiler works... " >&6; } -ac_link_default=`$as_echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the C++ compiler works" >&5 +printf %s "checking whether the C++ compiler works... " >&6; } +ac_link_default=`printf "%s\n" "$ac_link" | sed 's/ -o *conftest[^ ]*//'` # The possible output files: ac_files="a.out conftest.exe conftest a.exe a_out.exe b.out conftest.*" @@ -2502,11 +3081,12 @@ case "(($ac_try" in *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_link_default") 2>&5 ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; }; then : + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + test $ac_status = 0; } +then : # Autoconf-2.13 could set the ac_cv_exeext variable to `no'. # So ignore a value of `no', otherwise this would lead to `EXEEXT = no' # in a Makefile. We should not override ac_cv_exeext if it was cached, @@ -2523,7 +3103,7 @@ do # certainly right. break;; *.* ) - if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no; + if test ${ac_cv_exeext+y} && test "$ac_cv_exeext" != no; then :; else ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` fi @@ -2539,44 +3119,46 @@ do done test "$ac_cv_exeext" = no && ac_cv_exeext= -else +else $as_nop ac_file='' fi -if test -z "$ac_file"; then : - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } -$as_echo "$as_me: failed program was:" >&5 +if test -z "$ac_file" +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } +printf "%s\n" "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 -{ { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} +{ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error 77 "C++ compiler cannot create executables See \`config.log' for more details" "$LINENO" 5; } -else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 -$as_echo "yes" >&6; } -fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for C++ compiler default output file name" >&5 -$as_echo_n "checking for C++ compiler default output file name... " >&6; } -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_file" >&5 -$as_echo "$ac_file" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: yes" >&5 +printf "%s\n" "yes" >&6; } +fi +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C++ compiler default output file name" >&5 +printf %s "checking for C++ compiler default output file name... " >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_file" >&5 +printf "%s\n" "$ac_file" >&6; } ac_exeext=$ac_cv_exeext rm -f -r a.out a.out.dSYM a.exe conftest$ac_cv_exeext b.out ac_clean_files=$ac_clean_files_save -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of executables" >&5 -$as_echo_n "checking for suffix of executables... " >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for suffix of executables" >&5 +printf %s "checking for suffix of executables... " >&6; } if { { ac_try="$ac_link" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_link") 2>&5 ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; }; then : + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + test $ac_status = 0; } +then : # If both `conftest.exe' and `conftest' are `present' (well, observable) # catch `conftest.exe'. For instance with Cygwin, `ls conftest' will # work properly (i.e., refer to `conftest.exe'), while it won't with @@ -2590,15 +3172,15 @@ for ac_file in conftest.exe conftest conftest.*; do * ) break;; esac done -else - { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} +else $as_nop + { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "cannot compute suffix of executables: cannot compile and link See \`config.log' for more details" "$LINENO" 5; } fi rm -f conftest conftest$ac_cv_exeext -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_exeext" >&5 -$as_echo "$ac_cv_exeext" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_exeext" >&5 +printf "%s\n" "$ac_cv_exeext" >&6; } rm -f conftest.$ac_ext EXEEXT=$ac_cv_exeext @@ -2607,7 +3189,7 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include int -main () +main (void) { FILE *f = fopen ("conftest.out", "w"); return ferror (f) || fclose (f) != 0; @@ -2619,8 +3201,8 @@ _ACEOF ac_clean_files="$ac_clean_files conftest.out" # Check that the compiler produces executables we can run. If not, either # the compiler is broken, or we cross compile. -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are cross compiling" >&5 -$as_echo_n "checking whether we are cross compiling... " >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether we are cross compiling" >&5 +printf %s "checking whether we are cross compiling... " >&6; } if test "$cross_compiling" != yes; then { { ac_try="$ac_link" case "(($ac_try" in @@ -2628,10 +3210,10 @@ case "(($ac_try" in *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_link") 2>&5 ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } if { ac_try='./conftest$ac_cv_exeext' { { case "(($ac_try" in @@ -2639,39 +3221,40 @@ $as_echo "$ac_try_echo"; } >&5 *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_try") 2>&5 ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; }; }; then cross_compiling=no else if test "$cross_compiling" = maybe; then cross_compiling=yes else - { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} -as_fn_error $? "cannot run C++ compiled programs. + { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} +as_fn_error 77 "cannot run C++ compiled programs. If you meant to cross compile, use \`--host'. See \`config.log' for more details" "$LINENO" 5; } fi fi fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $cross_compiling" >&5 -$as_echo "$cross_compiling" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $cross_compiling" >&5 +printf "%s\n" "$cross_compiling" >&6; } rm -f conftest.$ac_ext conftest$ac_cv_exeext conftest.out ac_clean_files=$ac_clean_files_save -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for suffix of object files" >&5 -$as_echo_n "checking for suffix of object files... " >&6; } -if ${ac_cv_objext+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for suffix of object files" >&5 +printf %s "checking for suffix of object files... " >&6; } +if test ${ac_cv_objext+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; @@ -2685,11 +3268,12 @@ case "(($ac_try" in *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_compile") 2>&5 ac_status=$? - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 - test $ac_status = 0; }; then : + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + test $ac_status = 0; } +then : for ac_file in conftest.o conftest.obj conftest.*; do test -f "$ac_file" || continue; case $ac_file in @@ -2698,31 +3282,32 @@ $as_echo "$ac_try_echo"; } >&5 break;; esac done -else - $as_echo "$as_me: failed program was:" >&5 +else $as_nop + printf "%s\n" "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 -{ { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} +{ { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "cannot compute suffix of object files: cannot compile See \`config.log' for more details" "$LINENO" 5; } fi rm -f conftest.$ac_cv_objext conftest.$ac_ext fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_objext" >&5 -$as_echo "$ac_cv_objext" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_objext" >&5 +printf "%s\n" "$ac_cv_objext" >&6; } OBJEXT=$ac_cv_objext ac_objext=$OBJEXT -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are using the GNU C++ compiler" >&5 -$as_echo_n "checking whether we are using the GNU C++ compiler... " >&6; } -if ${ac_cv_cxx_compiler_gnu+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the compiler supports GNU C++" >&5 +printf %s "checking whether the compiler supports GNU C++... " >&6; } +if test ${ac_cv_cxx_compiler_gnu+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { #ifndef __GNUC__ choke me @@ -2732,29 +3317,33 @@ main () return 0; } _ACEOF -if ac_fn_cxx_try_compile "$LINENO"; then : +if ac_fn_cxx_try_compile "$LINENO" +then : ac_compiler_gnu=yes -else +else $as_nop ac_compiler_gnu=no fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext ac_cv_cxx_compiler_gnu=$ac_compiler_gnu fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_cxx_compiler_gnu" >&5 -$as_echo "$ac_cv_cxx_compiler_gnu" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_cxx_compiler_gnu" >&5 +printf "%s\n" "$ac_cv_cxx_compiler_gnu" >&6; } +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu + if test $ac_compiler_gnu = yes; then GXX=yes else GXX= fi -ac_test_CXXFLAGS=${CXXFLAGS+set} +ac_test_CXXFLAGS=${CXXFLAGS+y} ac_save_CXXFLAGS=$CXXFLAGS -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CXX accepts -g" >&5 -$as_echo_n "checking whether $CXX accepts -g... " >&6; } -if ${ac_cv_prog_cxx_g+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether $CXX accepts -g" >&5 +printf %s "checking whether $CXX accepts -g... " >&6; } +if test ${ac_cv_prog_cxx_g+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_save_cxx_werror_flag=$ac_cxx_werror_flag ac_cxx_werror_flag=yes ac_cv_prog_cxx_g=no @@ -2763,57 +3352,60 @@ else /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_cxx_try_compile "$LINENO"; then : +if ac_fn_cxx_try_compile "$LINENO" +then : ac_cv_prog_cxx_g=yes -else +else $as_nop CXXFLAGS="" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_cxx_try_compile "$LINENO"; then : +if ac_fn_cxx_try_compile "$LINENO" +then : -else +else $as_nop ac_cxx_werror_flag=$ac_save_cxx_werror_flag CXXFLAGS="-g" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_cxx_try_compile "$LINENO"; then : +if ac_fn_cxx_try_compile "$LINENO" +then : ac_cv_prog_cxx_g=yes fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext ac_cxx_werror_flag=$ac_save_cxx_werror_flag fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_g" >&5 -$as_echo "$ac_cv_prog_cxx_g" >&6; } -if test "$ac_test_CXXFLAGS" = set; then +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_g" >&5 +printf "%s\n" "$ac_cv_prog_cxx_g" >&6; } +if test $ac_test_CXXFLAGS; then CXXFLAGS=$ac_save_CXXFLAGS elif test $ac_cv_prog_cxx_g = yes; then if test "$GXX" = yes; then @@ -2828,12 +3420,115 @@ else CXXFLAGS= fi fi +ac_prog_cxx_stdcxx=no +if test x$ac_prog_cxx_stdcxx = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CXX option to enable C++11 features" >&5 +printf %s "checking for $CXX option to enable C++11 features... " >&6; } +if test ${ac_cv_prog_cxx_11+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_cv_prog_cxx_11=no +ac_save_CXX=$CXX +cat confdefs.h - <<_ACEOF >conftest.$ac_ext +/* end confdefs.h. */ +$ac_cxx_conftest_cxx11_program +_ACEOF +for ac_arg in '' -std=gnu++11 -std=gnu++0x -std=c++11 -std=c++0x -qlanglvl=extended0x -AA +do + CXX="$ac_save_CXX $ac_arg" + if ac_fn_cxx_try_compile "$LINENO" +then : + ac_cv_prog_cxx_cxx11=$ac_arg +fi +rm -f core conftest.err conftest.$ac_objext conftest.beam + test "x$ac_cv_prog_cxx_cxx11" != "xno" && break +done +rm -f conftest.$ac_ext +CXX=$ac_save_CXX +fi + +if test "x$ac_cv_prog_cxx_cxx11" = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 +printf "%s\n" "unsupported" >&6; } +else $as_nop + if test "x$ac_cv_prog_cxx_cxx11" = x +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 +printf "%s\n" "none needed" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_cxx11" >&5 +printf "%s\n" "$ac_cv_prog_cxx_cxx11" >&6; } + CXX="$CXX $ac_cv_prog_cxx_cxx11" +fi + ac_cv_prog_cxx_stdcxx=$ac_cv_prog_cxx_cxx11 + ac_prog_cxx_stdcxx=cxx11 +fi +fi +if test x$ac_prog_cxx_stdcxx = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CXX option to enable C++98 features" >&5 +printf %s "checking for $CXX option to enable C++98 features... " >&6; } +if test ${ac_cv_prog_cxx_98+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_cv_prog_cxx_98=no +ac_save_CXX=$CXX +cat confdefs.h - <<_ACEOF >conftest.$ac_ext +/* end confdefs.h. */ +$ac_cxx_conftest_cxx98_program +_ACEOF +for ac_arg in '' -std=gnu++98 -std=c++98 -qlanglvl=extended -AA +do + CXX="$ac_save_CXX $ac_arg" + if ac_fn_cxx_try_compile "$LINENO" +then : + ac_cv_prog_cxx_cxx98=$ac_arg +fi +rm -f core conftest.err conftest.$ac_objext conftest.beam + test "x$ac_cv_prog_cxx_cxx98" != "xno" && break +done +rm -f conftest.$ac_ext +CXX=$ac_save_CXX +fi + +if test "x$ac_cv_prog_cxx_cxx98" = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 +printf "%s\n" "unsupported" >&6; } +else $as_nop + if test "x$ac_cv_prog_cxx_cxx98" = x +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 +printf "%s\n" "none needed" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cxx_cxx98" >&5 +printf "%s\n" "$ac_cv_prog_cxx_cxx98" >&6; } + CXX="$CXX $ac_cv_prog_cxx_cxx98" +fi + ac_cv_prog_cxx_stdcxx=$ac_cv_prog_cxx_cxx98 + ac_prog_cxx_stdcxx=cxx98 +fi +fi + ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu + + + + + + + + + ac_ext=c ac_cpp='$CPP $CPPFLAGS' ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' @@ -2842,11 +3537,12 @@ ac_compiler_gnu=$ac_cv_c_compiler_gnu if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. set dummy ${ac_tool_prefix}gcc; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else @@ -2854,11 +3550,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_CC="${ac_tool_prefix}gcc" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -2869,11 +3569,11 @@ fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 -$as_echo "$CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 +printf "%s\n" "$CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -2882,11 +3582,12 @@ if test -z "$ac_cv_prog_CC"; then ac_ct_CC=$CC # Extract the first word of "gcc", so it can be a program name with args. set dummy gcc; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_ac_ct_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_ac_ct_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else @@ -2894,11 +3595,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CC="gcc" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -2909,11 +3614,11 @@ fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 -$as_echo "$ac_ct_CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 +printf "%s\n" "$ac_ct_CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi if test "x$ac_ct_CC" = x; then @@ -2921,8 +3626,8 @@ fi else case $cross_compiling:$ac_tool_warned in yes:) -{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 -$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 +printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC @@ -2935,11 +3640,12 @@ if test -z "$CC"; then if test -n "$ac_tool_prefix"; then # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. set dummy ${ac_tool_prefix}cc; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else @@ -2947,11 +3653,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_CC="${ac_tool_prefix}cc" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -2962,11 +3672,11 @@ fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 -$as_echo "$CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 +printf "%s\n" "$CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -2975,11 +3685,12 @@ fi if test -z "$CC"; then # Extract the first word of "cc", so it can be a program name with args. set dummy cc; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else @@ -2988,15 +3699,19 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then - if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then + if test "$as_dir$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then ac_prog_rejected=yes continue fi ac_cv_prog_CC="cc" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -3012,18 +3727,18 @@ if test $ac_prog_rejected = yes; then # However, it has the same basename, so the bogon will be chosen # first if we set CC to just the basename; use the full file name. shift - ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" + ac_cv_prog_CC="$as_dir$ac_word${1+' '}$@" fi fi fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 -$as_echo "$CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 +printf "%s\n" "$CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -3034,11 +3749,12 @@ if test -z "$CC"; then do # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. set dummy $ac_tool_prefix$ac_prog; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$CC"; then ac_cv_prog_CC="$CC" # Let the user override the test. else @@ -3046,11 +3762,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_CC="$ac_tool_prefix$ac_prog" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -3061,11 +3781,11 @@ fi fi CC=$ac_cv_prog_CC if test -n "$CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 -$as_echo "$CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 +printf "%s\n" "$CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -3078,11 +3798,12 @@ if test -z "$CC"; then do # Extract the first word of "$ac_prog", so it can be a program name with args. set dummy $ac_prog; ac_word=$2 -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 -$as_echo_n "checking for $ac_word... " >&6; } -if ${ac_cv_prog_ac_ct_CC+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_ac_ct_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop if test -n "$ac_ct_CC"; then ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. else @@ -3090,11 +3811,15 @@ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_word$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then ac_cv_prog_ac_ct_CC="$ac_prog" - $as_echo "$as_me:${as_lineno-$LINENO}: found $as_dir/$ac_word$ac_exec_ext" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 break 2 fi done @@ -3105,11 +3830,11 @@ fi fi ac_ct_CC=$ac_cv_prog_ac_ct_CC if test -n "$ac_ct_CC"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 -$as_echo "$ac_ct_CC" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 +printf "%s\n" "$ac_ct_CC" >&6; } else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } fi @@ -3121,34 +3846,138 @@ done else case $cross_compiling:$ac_tool_warned in yes:) -{ $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 -$as_echo "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 +printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} ac_tool_warned=yes ;; esac CC=$ac_ct_CC fi fi +fi +if test -z "$CC"; then + if test -n "$ac_tool_prefix"; then + # Extract the first word of "${ac_tool_prefix}clang", so it can be a program name with args. +set dummy ${ac_tool_prefix}clang; ac_word=$2 +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop + if test -n "$CC"; then + ac_cv_prog_CC="$CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + for ac_exec_ext in '' $ac_executable_extensions; do + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then + ac_cv_prog_CC="${ac_tool_prefix}clang" + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 + break 2 + fi +done + done +IFS=$as_save_IFS + +fi +fi +CC=$ac_cv_prog_CC +if test -n "$CC"; then + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $CC" >&5 +printf "%s\n" "$CC" >&6; } +else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } +fi + + +fi +if test -z "$ac_cv_prog_CC"; then + ac_ct_CC=$CC + # Extract the first word of "clang", so it can be a program name with args. +set dummy clang; ac_word=$2 +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $ac_word" >&5 +printf %s "checking for $ac_word... " >&6; } +if test ${ac_cv_prog_ac_ct_CC+y} +then : + printf %s "(cached) " >&6 +else $as_nop + if test -n "$ac_ct_CC"; then + ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + for ac_exec_ext in '' $ac_executable_extensions; do + if as_fn_executable_p "$as_dir$ac_word$ac_exec_ext"; then + ac_cv_prog_ac_ct_CC="clang" + printf "%s\n" "$as_me:${as_lineno-$LINENO}: found $as_dir$ac_word$ac_exec_ext" >&5 + break 2 + fi +done + done +IFS=$as_save_IFS + +fi +fi +ac_ct_CC=$ac_cv_prog_ac_ct_CC +if test -n "$ac_ct_CC"; then + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_ct_CC" >&5 +printf "%s\n" "$ac_ct_CC" >&6; } +else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } +fi + + if test "x$ac_ct_CC" = x; then + CC="" + else + case $cross_compiling:$ac_tool_warned in +yes:) +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: using cross tools not prefixed with host triplet" >&5 +printf "%s\n" "$as_me: WARNING: using cross tools not prefixed with host triplet" >&2;} +ac_tool_warned=yes ;; +esac + CC=$ac_ct_CC + fi +else + CC="$ac_cv_prog_CC" +fi + fi -test -z "$CC" && { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} +test -z "$CC" && { { printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 +printf "%s\n" "$as_me: error: in \`$ac_pwd':" >&2;} as_fn_error $? "no acceptable C compiler found in \$PATH See \`config.log' for more details" "$LINENO" 5; } # Provide some information about the compiler. -$as_echo "$as_me:${as_lineno-$LINENO}: checking for C compiler version" >&5 +printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for C compiler version" >&5 set X $ac_compile ac_compiler=$2 -for ac_option in --version -v -V -qversion; do +for ac_option in --version -v -V -qversion -version; do { { ac_try="$ac_compiler $ac_option >&5" case "(($ac_try" in *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; *) ac_try_echo=$ac_try;; esac eval ac_try_echo="\"\$as_me:${as_lineno-$LINENO}: $ac_try_echo\"" -$as_echo "$ac_try_echo"; } >&5 +printf "%s\n" "$ac_try_echo"; } >&5 (eval "$ac_compiler $ac_option >&5") 2>conftest.err ac_status=$? if test -s conftest.err; then @@ -3158,20 +3987,21 @@ $as_echo "$ac_try_echo"; } >&5 cat conftest.er1 >&5 fi rm -f conftest.er1 conftest.err - $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } done -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether we are using the GNU C compiler" >&5 -$as_echo_n "checking whether we are using the GNU C compiler... " >&6; } -if ${ac_cv_c_compiler_gnu+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether the compiler supports GNU C" >&5 +printf %s "checking whether the compiler supports GNU C... " >&6; } +if test ${ac_cv_c_compiler_gnu+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { #ifndef __GNUC__ choke me @@ -3181,29 +4011,33 @@ main () return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : ac_compiler_gnu=yes -else +else $as_nop ac_compiler_gnu=no fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext ac_cv_c_compiler_gnu=$ac_compiler_gnu fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_compiler_gnu" >&5 -$as_echo "$ac_cv_c_compiler_gnu" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_compiler_gnu" >&5 +printf "%s\n" "$ac_cv_c_compiler_gnu" >&6; } +ac_compiler_gnu=$ac_cv_c_compiler_gnu + if test $ac_compiler_gnu = yes; then GCC=yes else GCC= fi -ac_test_CFLAGS=${CFLAGS+set} +ac_test_CFLAGS=${CFLAGS+y} ac_save_CFLAGS=$CFLAGS -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether $CC accepts -g" >&5 -$as_echo_n "checking whether $CC accepts -g... " >&6; } -if ${ac_cv_prog_cc_g+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether $CC accepts -g" >&5 +printf %s "checking whether $CC accepts -g... " >&6; } +if test ${ac_cv_prog_cc_g+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_save_c_werror_flag=$ac_c_werror_flag ac_c_werror_flag=yes ac_cv_prog_cc_g=no @@ -3212,57 +4046,60 @@ else /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : ac_cv_prog_cc_g=yes -else +else $as_nop CFLAGS="" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : -else +else $as_nop ac_c_werror_flag=$ac_save_c_werror_flag CFLAGS="-g" cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ int -main () +main (void) { ; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : ac_cv_prog_cc_g=yes fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext ac_c_werror_flag=$ac_save_c_werror_flag fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_g" >&5 -$as_echo "$ac_cv_prog_cc_g" >&6; } -if test "$ac_test_CFLAGS" = set; then +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_g" >&5 +printf "%s\n" "$ac_cv_prog_cc_g" >&6; } +if test $ac_test_CFLAGS; then CFLAGS=$ac_save_CFLAGS elif test $ac_cv_prog_cc_g = yes; then if test "$GCC" = yes; then @@ -3277,94 +4114,144 @@ else CFLAGS= fi fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for $CC option to accept ISO C89" >&5 -$as_echo_n "checking for $CC option to accept ISO C89... " >&6; } -if ${ac_cv_prog_cc_c89+:} false; then : - $as_echo_n "(cached) " >&6 -else - ac_cv_prog_cc_c89=no +ac_prog_cc_stdc=no +if test x$ac_prog_cc_stdc = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C11 features" >&5 +printf %s "checking for $CC option to enable C11 features... " >&6; } +if test ${ac_cv_prog_cc_c11+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_cv_prog_cc_c11=no ac_save_CC=$CC cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ -#include -#include -struct stat; -/* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ -struct buf { int x; }; -FILE * (*rcsopen) (struct buf *, struct stat *, int); -static char *e (p, i) - char **p; - int i; -{ - return p[i]; -} -static char *f (char * (*g) (char **, int), char **p, ...) -{ - char *s; - va_list v; - va_start (v,p); - s = g (p, va_arg (v,int)); - va_end (v); - return s; -} - -/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has - function prototypes and stuff, but not '\xHH' hex character constants. - These don't provoke an error unfortunately, instead are silently treated - as 'x'. The following induces an error, until -std is added to get - proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an - array size at least. It's necessary to write '\x00'==0 to get something - that's true only with -std. */ -int osf4_cc_array ['\x00' == 0 ? 1 : -1]; +$ac_c_conftest_c11_program +_ACEOF +for ac_arg in '' -std=gnu11 +do + CC="$ac_save_CC $ac_arg" + if ac_fn_c_try_compile "$LINENO" +then : + ac_cv_prog_cc_c11=$ac_arg +fi +rm -f core conftest.err conftest.$ac_objext conftest.beam + test "x$ac_cv_prog_cc_c11" != "xno" && break +done +rm -f conftest.$ac_ext +CC=$ac_save_CC +fi -/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters - inside strings and character constants. */ -#define FOO(x) 'x' -int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1]; +if test "x$ac_cv_prog_cc_c11" = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 +printf "%s\n" "unsupported" >&6; } +else $as_nop + if test "x$ac_cv_prog_cc_c11" = x +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 +printf "%s\n" "none needed" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c11" >&5 +printf "%s\n" "$ac_cv_prog_cc_c11" >&6; } + CC="$CC $ac_cv_prog_cc_c11" +fi + ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c11 + ac_prog_cc_stdc=c11 +fi +fi +if test x$ac_prog_cc_stdc = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C99 features" >&5 +printf %s "checking for $CC option to enable C99 features... " >&6; } +if test ${ac_cv_prog_cc_c99+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_cv_prog_cc_c99=no +ac_save_CC=$CC +cat confdefs.h - <<_ACEOF >conftest.$ac_ext +/* end confdefs.h. */ +$ac_c_conftest_c99_program +_ACEOF +for ac_arg in '' -std=gnu99 -std=c99 -c99 -qlanglvl=extc1x -qlanglvl=extc99 -AC99 -D_STDC_C99= +do + CC="$ac_save_CC $ac_arg" + if ac_fn_c_try_compile "$LINENO" +then : + ac_cv_prog_cc_c99=$ac_arg +fi +rm -f core conftest.err conftest.$ac_objext conftest.beam + test "x$ac_cv_prog_cc_c99" != "xno" && break +done +rm -f conftest.$ac_ext +CC=$ac_save_CC +fi -int test (int i, double x); -struct s1 {int (*f) (int a);}; -struct s2 {int (*f) (double a);}; -int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); -int argc; -char **argv; -int -main () -{ -return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; - ; - return 0; -} +if test "x$ac_cv_prog_cc_c99" = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 +printf "%s\n" "unsupported" >&6; } +else $as_nop + if test "x$ac_cv_prog_cc_c99" = x +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 +printf "%s\n" "none needed" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c99" >&5 +printf "%s\n" "$ac_cv_prog_cc_c99" >&6; } + CC="$CC $ac_cv_prog_cc_c99" +fi + ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c99 + ac_prog_cc_stdc=c99 +fi +fi +if test x$ac_prog_cc_stdc = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for $CC option to enable C89 features" >&5 +printf %s "checking for $CC option to enable C89 features... " >&6; } +if test ${ac_cv_prog_cc_c89+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_cv_prog_cc_c89=no +ac_save_CC=$CC +cat confdefs.h - <<_ACEOF >conftest.$ac_ext +/* end confdefs.h. */ +$ac_c_conftest_c89_program _ACEOF -for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \ - -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" +for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" do CC="$ac_save_CC $ac_arg" - if ac_fn_c_try_compile "$LINENO"; then : + if ac_fn_c_try_compile "$LINENO" +then : ac_cv_prog_cc_c89=$ac_arg fi -rm -f core conftest.err conftest.$ac_objext +rm -f core conftest.err conftest.$ac_objext conftest.beam test "x$ac_cv_prog_cc_c89" != "xno" && break done rm -f conftest.$ac_ext CC=$ac_save_CC - fi -# AC_CACHE_VAL -case "x$ac_cv_prog_cc_c89" in - x) - { $as_echo "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 -$as_echo "none needed" >&6; } ;; - xno) - { $as_echo "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 -$as_echo "unsupported" >&6; } ;; - *) - CC="$CC $ac_cv_prog_cc_c89" - { $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c89" >&5 -$as_echo "$ac_cv_prog_cc_c89" >&6; } ;; -esac -if test "x$ac_cv_prog_cc_c89" != xno; then : +if test "x$ac_cv_prog_cc_c89" = xno +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: unsupported" >&5 +printf "%s\n" "unsupported" >&6; } +else $as_nop + if test "x$ac_cv_prog_cc_c89" = x +then : + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: none needed" >&5 +printf "%s\n" "none needed" >&6; } +else $as_nop + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_prog_cc_c89" >&5 +printf "%s\n" "$ac_cv_prog_cc_c89" >&6; } + CC="$CC $ac_cv_prog_cc_c89" +fi + ac_cv_prog_cc_stdc=$ac_cv_prog_cc_c89 + ac_prog_cc_stdc=c89 +fi fi ac_ext=c @@ -3373,36 +4260,9 @@ ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' ac_compiler_gnu=$ac_cv_c_compiler_gnu -ac_aux_dir= -for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do - if test -f "$ac_dir/install-sh"; then - ac_aux_dir=$ac_dir - ac_install_sh="$ac_aux_dir/install-sh -c" - break - elif test -f "$ac_dir/install.sh"; then - ac_aux_dir=$ac_dir - ac_install_sh="$ac_aux_dir/install.sh -c" - break - elif test -f "$ac_dir/shtool"; then - ac_aux_dir=$ac_dir - ac_install_sh="$ac_aux_dir/shtool install -c" - break - fi -done -if test -z "$ac_aux_dir"; then - as_fn_error $? "cannot find install-sh, install.sh, or shtool in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" "$LINENO" 5 -fi - -# These three variables are undocumented and unsupported, -# and are intended to be withdrawn in a future Autoconf release. -# They can cause serious problems if a builder's source tree is in a directory -# whose full name contains unusual characters. -ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. -ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. -ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. -# Find a good install program. We prefer a C program (faster), + # Find a good install program. We prefer a C program (faster), # so one script is as good as another. But avoid the broken or # incompatible versions: # SysV /etc/install, /usr/sbin/install @@ -3416,20 +4276,25 @@ ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. # OS/2's system install, which has a completely different semantic # ./install, which can be erroneously created by make from ./install.sh. # Reject install programs that cannot install multiple files. -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5 -$as_echo_n "checking for a BSD-compatible install... " >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for a BSD-compatible install" >&5 +printf %s "checking for a BSD-compatible install... " >&6; } if test -z "$INSTALL"; then -if ${ac_cv_path_install+:} false; then : - $as_echo_n "(cached) " >&6 -else +if test ${ac_cv_path_install+y} +then : + printf %s "(cached) " >&6 +else $as_nop as_save_IFS=$IFS; IFS=$PATH_SEPARATOR for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - # Account for people who put trailing slashes in PATH elements. -case $as_dir/ in #(( - ./ | .// | /[cC]/* | \ + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + # Account for fact that we put trailing slashes in our PATH walk. +case $as_dir in #(( + ./ | /[cC]/* | \ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ ?:[\\/]os2[\\/]install[\\/]* | ?:[\\/]OS2[\\/]INSTALL[\\/]* | \ /usr/ucb/* ) ;; @@ -3439,13 +4304,13 @@ case $as_dir/ in #(( # by default. for ac_prog in ginstall scoinst install; do for ac_exec_ext in '' $ac_executable_extensions; do - if as_fn_executable_p "$as_dir/$ac_prog$ac_exec_ext"; then + if as_fn_executable_p "$as_dir$ac_prog$ac_exec_ext"; then if test $ac_prog = install && - grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then + grep dspmsg "$as_dir$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # AIX install. It has an incompatible calling convention. : elif test $ac_prog = install && - grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then + grep pwplus "$as_dir$ac_prog$ac_exec_ext" >/dev/null 2>&1; then # program-specific install script used by HP pwplus--don't use. : else @@ -3453,12 +4318,12 @@ case $as_dir/ in #(( echo one > conftest.one echo two > conftest.two mkdir conftest.dir - if "$as_dir/$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir" && + if "$as_dir$ac_prog$ac_exec_ext" -c conftest.one conftest.two "`pwd`/conftest.dir/" && test -s conftest.one && test -s conftest.two && test -s conftest.dir/conftest.one && test -s conftest.dir/conftest.two then - ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" + ac_cv_path_install="$as_dir$ac_prog$ac_exec_ext -c" break 3 fi fi @@ -3474,7 +4339,7 @@ IFS=$as_save_IFS rm -rf conftest.one conftest.two conftest.dir fi - if test "${ac_cv_path_install+set}" = set; then + if test ${ac_cv_path_install+y}; then INSTALL=$ac_cv_path_install else # As a last resort, use the slow shell script. Don't cache a @@ -3484,8 +4349,8 @@ fi INSTALL=$ac_install_sh fi fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5 -$as_echo "$INSTALL" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $INSTALL" >&5 +printf "%s\n" "$INSTALL" >&6; } # Use test -z because SunOS4 sh mishandles braces in ${var-val}. # It thinks the first close brace ends the variable substitution. @@ -3495,13 +4360,14 @@ test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5 -$as_echo_n "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking whether ${MAKE-make} sets \$(MAKE)" >&5 +printf %s "checking whether ${MAKE-make} sets \$(MAKE)... " >&6; } set x ${MAKE-make} -ac_make=`$as_echo "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` -if eval \${ac_cv_prog_make_${ac_make}_set+:} false; then : - $as_echo_n "(cached) " >&6 -else +ac_make=`printf "%s\n" "$2" | sed 's/+/p/g; s/[^a-zA-Z0-9_]/_/g'` +if eval test \${ac_cv_prog_make_${ac_make}_set+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat >conftest.make <<\_ACEOF SHELL = /bin/sh all: @@ -3517,12 +4383,12 @@ esac rm -f conftest.make fi if eval test \$ac_cv_prog_make_${ac_make}_set = yes; then - { $as_echo "$as_me:${as_lineno-$LINENO}: result: yes" >&5 -$as_echo "yes" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: yes" >&5 +printf "%s\n" "yes" >&6; } SET_MAKE= else - { $as_echo "$as_me:${as_lineno-$LINENO}: result: no" >&5 -$as_echo "no" >&6; } + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: no" >&5 +printf "%s\n" "no" >&6; } SET_MAKE="MAKE=${MAKE-make}" fi @@ -3538,11 +4404,12 @@ esac # Checks for libraries. -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for sha256_Raw in -lbc-crypto-base" >&5 -$as_echo_n "checking for sha256_Raw in -lbc-crypto-base... " >&6; } -if ${ac_cv_lib_bc_crypto_base_sha256_Raw+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for sha256_Raw in -lbc-crypto-base" >&5 +printf %s "checking for sha256_Raw in -lbc-crypto-base... " >&6; } +if test ${ac_cv_lib_bc_crypto_base_sha256_Raw+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-lbc-crypto-base $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3551,48 +4418,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char sha256_Raw (); int -main () +main (void) { return sha256_Raw (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_bc_crypto_base_sha256_Raw=yes -else +else $as_nop ac_cv_lib_bc_crypto_base_sha256_Raw=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_crypto_base_sha256_Raw" >&5 -$as_echo "$ac_cv_lib_bc_crypto_base_sha256_Raw" >&6; } -if test "x$ac_cv_lib_bc_crypto_base_sha256_Raw" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBBC_CRYPTO_BASE 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_crypto_base_sha256_Raw" >&5 +printf "%s\n" "$ac_cv_lib_bc_crypto_base_sha256_Raw" >&6; } +if test "x$ac_cv_lib_bc_crypto_base_sha256_Raw" = xyes +then : + printf "%s\n" "#define HAVE_LIBBC_CRYPTO_BASE 1" >>confdefs.h LIBS="-lbc-crypto-base $LIBS" -else +else $as_nop echo "### Error! libbc-crypto-base must be installed first." exit -1 fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for split_secret in -lbc-shamir" >&5 -$as_echo_n "checking for split_secret in -lbc-shamir... " >&6; } -if ${ac_cv_lib_bc_shamir_split_secret+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for split_secret in -lbc-shamir" >&5 +printf %s "checking for split_secret in -lbc-shamir... " >&6; } +if test ${ac_cv_lib_bc_shamir_split_secret+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-lbc-shamir $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3601,48 +4466,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char split_secret (); int -main () +main (void) { return split_secret (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_bc_shamir_split_secret=yes -else +else $as_nop ac_cv_lib_bc_shamir_split_secret=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_shamir_split_secret" >&5 -$as_echo "$ac_cv_lib_bc_shamir_split_secret" >&6; } -if test "x$ac_cv_lib_bc_shamir_split_secret" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBBC_SHAMIR 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_shamir_split_secret" >&5 +printf "%s\n" "$ac_cv_lib_bc_shamir_split_secret" >&6; } +if test "x$ac_cv_lib_bc_shamir_split_secret" = xyes +then : + printf "%s\n" "#define HAVE_LIBBC_SHAMIR 1" >>confdefs.h LIBS="-lbc-shamir $LIBS" -else +else $as_nop echo "### Error! libbc-shamir must be installed first." exit -1 fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for sskr_generate in -lbc-sskr" >&5 -$as_echo_n "checking for sskr_generate in -lbc-sskr... " >&6; } -if ${ac_cv_lib_bc_sskr_sskr_generate+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for sskr_generate in -lbc-sskr" >&5 +printf %s "checking for sskr_generate in -lbc-sskr... " >&6; } +if test ${ac_cv_lib_bc_sskr_sskr_generate+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-lbc-sskr $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3651,48 +4514,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char sskr_generate (); int -main () +main (void) { return sskr_generate (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_bc_sskr_sskr_generate=yes -else +else $as_nop ac_cv_lib_bc_sskr_sskr_generate=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_sskr_sskr_generate" >&5 -$as_echo "$ac_cv_lib_bc_sskr_sskr_generate" >&6; } -if test "x$ac_cv_lib_bc_sskr_sskr_generate" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBBC_SSKR 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_sskr_sskr_generate" >&5 +printf "%s\n" "$ac_cv_lib_bc_sskr_sskr_generate" >&6; } +if test "x$ac_cv_lib_bc_sskr_sskr_generate" = xyes +then : + printf "%s\n" "#define HAVE_LIBBC_SSKR 1" >>confdefs.h LIBS="-lbc-sskr $LIBS" -else +else $as_nop echo "### Error! libbc-sskr must be installed first." exit -1 fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for bip39_mnemonic_from_word in -lbc-bip39" >&5 -$as_echo_n "checking for bip39_mnemonic_from_word in -lbc-bip39... " >&6; } -if ${ac_cv_lib_bc_bip39_bip39_mnemonic_from_word+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for bip39_mnemonic_from_word in -lbc-bip39" >&5 +printf %s "checking for bip39_mnemonic_from_word in -lbc-bip39... " >&6; } +if test ${ac_cv_lib_bc_bip39_bip39_mnemonic_from_word+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-lbc-bip39 $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3701,48 +4562,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char bip39_mnemonic_from_word (); int -main () +main (void) { return bip39_mnemonic_from_word (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_bc_bip39_bip39_mnemonic_from_word=yes -else +else $as_nop ac_cv_lib_bc_bip39_bip39_mnemonic_from_word=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&5 -$as_echo "$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&6; } -if test "x$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBBC_BIP39 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&5 +printf "%s\n" "$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" >&6; } +if test "x$ac_cv_lib_bc_bip39_bip39_mnemonic_from_word" = xyes +then : + printf "%s\n" "#define HAVE_LIBBC_BIP39 1" >>confdefs.h LIBS="-lbc-bip39 $LIBS" -else +else $as_nop echo "### Error! libbc-bip39 must be installed first." exit -1 fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for ur_crc32n in -lbc-ur" >&5 -$as_echo_n "checking for ur_crc32n in -lbc-ur... " >&6; } -if ${ac_cv_lib_bc_ur_ur_crc32n+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for ur_crc32n in -lbc-ur" >&5 +printf %s "checking for ur_crc32n in -lbc-ur... " >&6; } +if test ${ac_cv_lib_bc_ur_ur_crc32n+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-lbc-ur $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3751,48 +4610,46 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char ur_crc32n (); int -main () +main (void) { return ur_crc32n (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_bc_ur_ur_crc32n=yes -else +else $as_nop ac_cv_lib_bc_ur_ur_crc32n=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_ur_ur_crc32n" >&5 -$as_echo "$ac_cv_lib_bc_ur_ur_crc32n" >&6; } -if test "x$ac_cv_lib_bc_ur_ur_crc32n" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBBC_UR 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_bc_ur_ur_crc32n" >&5 +printf "%s\n" "$ac_cv_lib_bc_ur_ur_crc32n" >&6; } +if test "x$ac_cv_lib_bc_ur_ur_crc32n" = xyes +then : + printf "%s\n" "#define HAVE_LIBBC_UR 1" >>confdefs.h LIBS="-lbc-ur $LIBS" -else +else $as_nop echo "### Error! libbc-ur must be installed first." exit -1 fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for argp_parse in -largp" >&5 -$as_echo_n "checking for argp_parse in -largp... " >&6; } -if ${ac_cv_lib_argp_argp_parse+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for argp_parse in -largp" >&5 +printf %s "checking for argp_parse in -largp... " >&6; } +if test ${ac_cv_lib_argp_argp_parse+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_check_lib_save_LIBS=$LIBS LIBS="-largp $LIBS" cat confdefs.h - <<_ACEOF >conftest.$ac_ext @@ -3801,37 +4658,34 @@ cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* Override any GCC internal prototype to avoid an error. Use char because int might match the return type of a GCC builtin and then its argument prototype would still apply. */ -#ifdef __cplusplus -extern "C" -#endif char argp_parse (); int -main () +main (void) { return argp_parse (); ; return 0; } _ACEOF -if ac_fn_c_try_link "$LINENO"; then : +if ac_fn_c_try_link "$LINENO" +then : ac_cv_lib_argp_argp_parse=yes -else +else $as_nop ac_cv_lib_argp_argp_parse=no fi -rm -f core conftest.err conftest.$ac_objext \ +rm -f core conftest.err conftest.$ac_objext conftest.beam \ conftest$ac_exeext conftest.$ac_ext LIBS=$ac_check_lib_save_LIBS fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_argp_argp_parse" >&5 -$as_echo "$ac_cv_lib_argp_argp_parse" >&6; } -if test "x$ac_cv_lib_argp_argp_parse" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_LIBARGP 1 -_ACEOF +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_lib_argp_argp_parse" >&5 +printf "%s\n" "$ac_cv_lib_argp_argp_parse" >&6; } +if test "x$ac_cv_lib_argp_argp_parse" = xyes +then : + printf "%s\n" "#define HAVE_LIBARGP 1" >>confdefs.h LIBS="-largp $LIBS" -else +else $as_nop echo "### Error! argp must be installed first. Try 'brew install argp-standalone'." exit -1 @@ -3840,531 +4694,262 @@ fi # Checks for header files. -ac_ext=c -ac_cpp='$CPP $CPPFLAGS' -ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' -ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' -ac_compiler_gnu=$ac_cv_c_compiler_gnu -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking how to run the C preprocessor" >&5 -$as_echo_n "checking how to run the C preprocessor... " >&6; } -# On Suns, sometimes $CPP names a directory. -if test -n "$CPP" && test -d "$CPP"; then - CPP= -fi -if test -z "$CPP"; then - if ${ac_cv_prog_CPP+:} false; then : - $as_echo_n "(cached) " >&6 -else - # Double quotes because CPP needs to be expanded - for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp" - do - ac_preproc_ok=false -for ac_c_preproc_warn_flag in '' yes +ac_header= ac_cache= +for ac_item in $ac_header_c_list do - # Use a header file that comes with gcc, so configuring glibc - # with a fresh cross-compiler works. - # Prefer to if __STDC__ is defined, since - # exists even on freestanding compilers. - # On the NeXT, cc -E runs the code through the compiler's parser, - # not just through cpp. "Syntax error" is here to catch this case. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#ifdef __STDC__ -# include -#else -# include -#endif - Syntax error -_ACEOF -if ac_fn_c_try_cpp "$LINENO"; then : - -else - # Broken: fails on valid input. -continue -fi -rm -f conftest.err conftest.i conftest.$ac_ext - - # OK, works on sane cases. Now check whether nonexistent headers - # can be detected and how. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include -_ACEOF -if ac_fn_c_try_cpp "$LINENO"; then : - # Broken: success on invalid input. -continue -else - # Passes both tests. -ac_preproc_ok=: -break -fi -rm -f conftest.err conftest.i conftest.$ac_ext - + if test $ac_cache; then + ac_fn_c_check_header_compile "$LINENO" $ac_header ac_cv_header_$ac_cache "$ac_includes_default" + if eval test \"x\$ac_cv_header_$ac_cache\" = xyes; then + printf "%s\n" "#define $ac_item 1" >> confdefs.h + fi + ac_header= ac_cache= + elif test $ac_header; then + ac_cache=$ac_item + else + ac_header=$ac_item + fi done -# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. -rm -f conftest.i conftest.err conftest.$ac_ext -if $ac_preproc_ok; then : - break -fi - - done - ac_cv_prog_CPP=$CPP -fi - CPP=$ac_cv_prog_CPP -else - ac_cv_prog_CPP=$CPP -fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $CPP" >&5 -$as_echo "$CPP" >&6; } -ac_preproc_ok=false -for ac_c_preproc_warn_flag in '' yes -do - # Use a header file that comes with gcc, so configuring glibc - # with a fresh cross-compiler works. - # Prefer to if __STDC__ is defined, since - # exists even on freestanding compilers. - # On the NeXT, cc -E runs the code through the compiler's parser, - # not just through cpp. "Syntax error" is here to catch this case. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#ifdef __STDC__ -# include -#else -# include -#endif - Syntax error -_ACEOF -if ac_fn_c_try_cpp "$LINENO"; then : -else - # Broken: fails on valid input. -continue -fi -rm -f conftest.err conftest.i conftest.$ac_ext - # OK, works on sane cases. Now check whether nonexistent headers - # can be detected and how. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include -_ACEOF -if ac_fn_c_try_cpp "$LINENO"; then : - # Broken: success on invalid input. -continue -else - # Passes both tests. -ac_preproc_ok=: -break -fi -rm -f conftest.err conftest.i conftest.$ac_ext -done -# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. -rm -f conftest.i conftest.err conftest.$ac_ext -if $ac_preproc_ok; then : -else - { { $as_echo "$as_me:${as_lineno-$LINENO}: error: in \`$ac_pwd':" >&5 -$as_echo "$as_me: error: in \`$ac_pwd':" >&2;} -as_fn_error $? "C preprocessor \"$CPP\" fails sanity check -See \`config.log' for more details" "$LINENO" 5; } -fi -ac_ext=c -ac_cpp='$CPP $CPPFLAGS' -ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' -ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' -ac_compiler_gnu=$ac_cv_c_compiler_gnu -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for grep that handles long lines and -e" >&5 -$as_echo_n "checking for grep that handles long lines and -e... " >&6; } -if ${ac_cv_path_GREP+:} false; then : - $as_echo_n "(cached) " >&6 -else - if test -z "$GREP"; then - ac_path_GREP_found=false - # Loop through the user's path and test for each of PROGNAME-LIST - as_save_IFS=$IFS; IFS=$PATH_SEPARATOR -for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin -do - IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - for ac_prog in grep ggrep; do - for ac_exec_ext in '' $ac_executable_extensions; do - ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext" - as_fn_executable_p "$ac_path_GREP" || continue -# Check for GNU ac_path_GREP and select it if it is found. - # Check for GNU $ac_path_GREP -case `"$ac_path_GREP" --version 2>&1` in -*GNU*) - ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;; -*) - ac_count=0 - $as_echo_n 0123456789 >"conftest.in" - while : - do - cat "conftest.in" "conftest.in" >"conftest.tmp" - mv "conftest.tmp" "conftest.in" - cp "conftest.in" "conftest.nl" - $as_echo 'GREP' >> "conftest.nl" - "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break - diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break - as_fn_arith $ac_count + 1 && ac_count=$as_val - if test $ac_count -gt ${ac_path_GREP_max-0}; then - # Best one so far, save it but keep looking for a better one - ac_cv_path_GREP="$ac_path_GREP" - ac_path_GREP_max=$ac_count - fi - # 10*(2^10) chars as input seems more than enough - test $ac_count -gt 10 && break - done - rm -f conftest.in conftest.tmp conftest.nl conftest.out;; -esac +if test $ac_cv_header_stdlib_h = yes && test $ac_cv_header_string_h = yes +then : - $ac_path_GREP_found && break 3 - done - done - done -IFS=$as_save_IFS - if test -z "$ac_cv_path_GREP"; then - as_fn_error $? "no acceptable grep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5 - fi -else - ac_cv_path_GREP=$GREP -fi +printf "%s\n" "#define STDC_HEADERS 1" >>confdefs.h fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_GREP" >&5 -$as_echo "$ac_cv_path_GREP" >&6; } - GREP="$ac_cv_path_GREP" - - -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for egrep" >&5 -$as_echo_n "checking for egrep... " >&6; } -if ${ac_cv_path_EGREP+:} false; then : - $as_echo_n "(cached) " >&6 -else - if echo a | $GREP -E '(a|b)' >/dev/null 2>&1 - then ac_cv_path_EGREP="$GREP -E" - else - if test -z "$EGREP"; then - ac_path_EGREP_found=false - # Loop through the user's path and test for each of PROGNAME-LIST - as_save_IFS=$IFS; IFS=$PATH_SEPARATOR -for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin -do - IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - for ac_prog in egrep; do - for ac_exec_ext in '' $ac_executable_extensions; do - ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext" - as_fn_executable_p "$ac_path_EGREP" || continue -# Check for GNU ac_path_EGREP and select it if it is found. - # Check for GNU $ac_path_EGREP -case `"$ac_path_EGREP" --version 2>&1` in -*GNU*) - ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;; -*) - ac_count=0 - $as_echo_n 0123456789 >"conftest.in" - while : - do - cat "conftest.in" "conftest.in" >"conftest.tmp" - mv "conftest.tmp" "conftest.in" - cp "conftest.in" "conftest.nl" - $as_echo 'EGREP' >> "conftest.nl" - "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break - diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break - as_fn_arith $ac_count + 1 && ac_count=$as_val - if test $ac_count -gt ${ac_path_EGREP_max-0}; then - # Best one so far, save it but keep looking for a better one - ac_cv_path_EGREP="$ac_path_EGREP" - ac_path_EGREP_max=$ac_count - fi - # 10*(2^10) chars as input seems more than enough - test $ac_count -gt 10 && break - done - rm -f conftest.in conftest.tmp conftest.nl conftest.out;; -esac +ac_fn_c_check_header_compile "$LINENO" "fcntl.h" "ac_cv_header_fcntl_h" "$ac_includes_default" +if test "x$ac_cv_header_fcntl_h" = xyes +then : + printf "%s\n" "#define HAVE_FCNTL_H 1" >>confdefs.h - $ac_path_EGREP_found && break 3 - done - done - done -IFS=$as_save_IFS - if test -z "$ac_cv_path_EGREP"; then - as_fn_error $? "no acceptable egrep could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" "$LINENO" 5 - fi -else - ac_cv_path_EGREP=$EGREP fi +ac_fn_c_check_header_compile "$LINENO" "memory.h" "ac_cv_header_memory_h" "$ac_includes_default" +if test "x$ac_cv_header_memory_h" = xyes +then : + printf "%s\n" "#define HAVE_MEMORY_H 1" >>confdefs.h - fi fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_path_EGREP" >&5 -$as_echo "$ac_cv_path_EGREP" >&6; } - EGREP="$ac_cv_path_EGREP" +ac_fn_c_check_header_compile "$LINENO" "stdint.h" "ac_cv_header_stdint_h" "$ac_includes_default" +if test "x$ac_cv_header_stdint_h" = xyes +then : + printf "%s\n" "#define HAVE_STDINT_H 1" >>confdefs.h - -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for ANSI C header files" >&5 -$as_echo_n "checking for ANSI C header files... " >&6; } -if ${ac_cv_header_stdc+:} false; then : - $as_echo_n "(cached) " >&6 -else - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include -#include -#include -#include - -int -main () -{ - - ; - return 0; -} -_ACEOF -if ac_fn_c_try_compile "$LINENO"; then : - ac_cv_header_stdc=yes -else - ac_cv_header_stdc=no fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext - -if test $ac_cv_header_stdc = yes; then - # SunOS 4.x string.h does not declare mem*, contrary to ANSI. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include - -_ACEOF -if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | - $EGREP "memchr" >/dev/null 2>&1; then : +ac_fn_c_check_header_compile "$LINENO" "stdlib.h" "ac_cv_header_stdlib_h" "$ac_includes_default" +if test "x$ac_cv_header_stdlib_h" = xyes +then : + printf "%s\n" "#define HAVE_STDLIB_H 1" >>confdefs.h -else - ac_cv_header_stdc=no fi -rm -f conftest* +ac_fn_c_check_header_compile "$LINENO" "string.h" "ac_cv_header_string_h" "$ac_includes_default" +if test "x$ac_cv_header_string_h" = xyes +then : + printf "%s\n" "#define HAVE_STRING_H 1" >>confdefs.h fi +ac_fn_c_check_header_compile "$LINENO" "strings.h" "ac_cv_header_strings_h" "$ac_includes_default" +if test "x$ac_cv_header_strings_h" = xyes +then : + printf "%s\n" "#define HAVE_STRINGS_H 1" >>confdefs.h -if test $ac_cv_header_stdc = yes; then - # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include - -_ACEOF -if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | - $EGREP "free" >/dev/null 2>&1; then : - -else - ac_cv_header_stdc=no fi -rm -f conftest* +ac_fn_c_check_header_compile "$LINENO" "sys/ioctl.h" "ac_cv_header_sys_ioctl_h" "$ac_includes_default" +if test "x$ac_cv_header_sys_ioctl_h" = xyes +then : + printf "%s\n" "#define HAVE_SYS_IOCTL_H 1" >>confdefs.h fi +ac_fn_c_check_header_compile "$LINENO" "sys/param.h" "ac_cv_header_sys_param_h" "$ac_includes_default" +if test "x$ac_cv_header_sys_param_h" = xyes +then : + printf "%s\n" "#define HAVE_SYS_PARAM_H 1" >>confdefs.h -if test $ac_cv_header_stdc = yes; then - # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. - if test "$cross_compiling" = yes; then : - : -else - cat confdefs.h - <<_ACEOF >conftest.$ac_ext -/* end confdefs.h. */ -#include -#include -#if ((' ' & 0x0FF) == 0x020) -# define ISLOWER(c) ('a' <= (c) && (c) <= 'z') -# define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) -#else -# define ISLOWER(c) \ - (('a' <= (c) && (c) <= 'i') \ - || ('j' <= (c) && (c) <= 'r') \ - || ('s' <= (c) && (c) <= 'z')) -# define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) -#endif - -#define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) -int -main () -{ - int i; - for (i = 0; i < 256; i++) - if (XOR (islower (i), ISLOWER (i)) - || toupper (i) != TOUPPER (i)) - return 2; - return 0; -} -_ACEOF -if ac_fn_c_try_run "$LINENO"; then : - -else - ac_cv_header_stdc=no -fi -rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \ - conftest.$ac_objext conftest.beam conftest.$ac_ext fi +ac_fn_c_check_header_compile "$LINENO" "unistd.h" "ac_cv_header_unistd_h" "$ac_includes_default" +if test "x$ac_cv_header_unistd_h" = xyes +then : + printf "%s\n" "#define HAVE_UNISTD_H 1" >>confdefs.h fi -fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdc" >&5 -$as_echo "$ac_cv_header_stdc" >&6; } -if test $ac_cv_header_stdc = yes; then - -$as_echo "#define STDC_HEADERS 1" >>confdefs.h +ac_fn_c_check_header_compile "$LINENO" "stddef.h" "ac_cv_header_stddef_h" "$ac_includes_default" +if test "x$ac_cv_header_stddef_h" = xyes +then : + printf "%s\n" "#define HAVE_STDDEF_H 1" >>confdefs.h fi -# On IRIX 5.3, sys/types and inttypes.h are conflicting. -for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \ - inttypes.h stdint.h unistd.h -do : - as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` -ac_fn_c_check_header_compile "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default -" -if eval test \"x\$"$as_ac_Header"\" = x"yes"; then : - cat >>confdefs.h <<_ACEOF -#define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 -_ACEOF - -fi -done +# Checks for typedefs, structures, and compiler characteristics. +ac_fn_c_check_type "$LINENO" "_Bool" "ac_cv_type__Bool" "$ac_includes_default" +if test "x$ac_cv_type__Bool" = xyes +then : +printf "%s\n" "#define HAVE__BOOL 1" >>confdefs.h -for ac_header in fcntl.h memory.h stdint.h stdlib.h string.h strings.h sys/ioctl.h sys/param.h unistd.h stddef.h -do : - as_ac_Header=`$as_echo "ac_cv_header_$ac_header" | $as_tr_sh` -ac_fn_c_check_header_mongrel "$LINENO" "$ac_header" "$as_ac_Header" "$ac_includes_default" -if eval test \"x\$"$as_ac_Header"\" = x"yes"; then : - cat >>confdefs.h <<_ACEOF -#define `$as_echo "HAVE_$ac_header" | $as_tr_cpp` 1 -_ACEOF fi -done - - -# Checks for typedefs, structures, and compiler characteristics. -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for stdbool.h that conforms to C99" >&5 -$as_echo_n "checking for stdbool.h that conforms to C99... " >&6; } -if ${ac_cv_header_stdbool_h+:} false; then : - $as_echo_n "(cached) " >&6 -else + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for stdbool.h that conforms to C99" >&5 +printf %s "checking for stdbool.h that conforms to C99... " >&6; } +if test ${ac_cv_header_stdbool_h+y} +then : + printf %s "(cached) " >&6 +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ +#include - #include - #ifndef bool - "error: bool is not defined" - #endif - #ifndef false - "error: false is not defined" - #endif - #if false - "error: false is not 0" + #ifndef __bool_true_false_are_defined + #error "__bool_true_false_are_defined is not defined" #endif - #ifndef true - "error: true is not defined" + char a[__bool_true_false_are_defined == 1 ? 1 : -1]; + + /* Regardless of whether this is C++ or "_Bool" is a + valid type name, "true" and "false" should be usable + in #if expressions and integer constant expressions, + and "bool" should be a valid type name. */ + + #if !true + #error "'true' is not true" #endif #if true != 1 - "error: true is not 1" + #error "'true' is not equal to 1" #endif - #ifndef __bool_true_false_are_defined - "error: __bool_true_false_are_defined is not defined" + char b[true == 1 ? 1 : -1]; + char c[true]; + + #if false + #error "'false' is not false" #endif + #if false != 0 + #error "'false' is not equal to 0" + #endif + char d[false == 0 ? 1 : -1]; + + enum { e = false, f = true, g = false * true, h = true * 256 }; + + char i[(bool) 0.5 == true ? 1 : -1]; + char j[(bool) 0.0 == false ? 1 : -1]; + char k[sizeof (bool) > 0 ? 1 : -1]; + + struct sb { bool s: 1; bool t; } s; + char l[sizeof s.t > 0 ? 1 : -1]; - struct s { _Bool s: 1; _Bool t; } s; - - char a[true == 1 ? 1 : -1]; - char b[false == 0 ? 1 : -1]; - char c[__bool_true_false_are_defined == 1 ? 1 : -1]; - char d[(bool) 0.5 == true ? 1 : -1]; - /* See body of main program for 'e'. */ - char f[(_Bool) 0.0 == false ? 1 : -1]; - char g[true]; - char h[sizeof (_Bool)]; - char i[sizeof s.t]; - enum { j = false, k = true, l = false * true, m = true * 256 }; /* The following fails for HP aC++/ANSI C B3910B A.05.55 [Dec 04 2003]. */ - _Bool n[m]; - char o[sizeof n == m * sizeof n[0] ? 1 : -1]; - char p[-1 - (_Bool) 0 < 0 && -1 - (bool) 0 < 0 ? 1 : -1]; + bool m[h]; + char n[sizeof m == h * sizeof m[0] ? 1 : -1]; + char o[-1 - (bool) 0 < 0 ? 1 : -1]; /* Catch a bug in an HP-UX C compiler. See - http://gcc.gnu.org/ml/gcc-patches/2003-12/msg02303.html - http://lists.gnu.org/archive/html/bug-coreutils/2005-11/msg00161.html + https://gcc.gnu.org/ml/gcc-patches/2003-12/msg02303.html + https://lists.gnu.org/archive/html/bug-coreutils/2005-11/msg00161.html */ - _Bool q = true; - _Bool *pq = &q; + bool p = true; + bool *pp = &p; + + /* C 1999 specifies that bool, true, and false are to be + macros, but C++ 2011 and later overrule this. */ + #if __cplusplus < 201103 + #ifndef bool + #error "bool is not defined" + #endif + #ifndef false + #error "false is not defined" + #endif + #ifndef true + #error "true is not defined" + #endif + #endif + + /* If _Bool is available, repeat with it all the tests + above that used bool. */ + #ifdef HAVE__BOOL + struct sB { _Bool s: 1; _Bool t; } t; + + char q[(_Bool) 0.5 == true ? 1 : -1]; + char r[(_Bool) 0.0 == false ? 1 : -1]; + char u[sizeof (_Bool) > 0 ? 1 : -1]; + char v[sizeof t.t > 0 ? 1 : -1]; + + _Bool w[h]; + char x[sizeof m == h * sizeof m[0] ? 1 : -1]; + char y[-1 - (_Bool) 0 < 0 ? 1 : -1]; + _Bool z = true; + _Bool *pz = &p; + #endif int -main () +main (void) { - bool e = &s; - *pq |= q; - *pq |= ! q; - /* Refer to every declared value, to avoid compiler optimizations. */ - return (!a + !b + !c + !d + !e + !f + !g + !h + !i + !!j + !k + !!l - + !m + !n + !o + !p + !q + !pq); + bool ps = &s; + *pp |= p; + *pp |= ! p; + + #ifdef HAVE__BOOL + _Bool pt = &t; + *pz |= z; + *pz |= ! z; + #endif + + /* Refer to every declared value, so they cannot be + discarded as unused. */ + return (!a + !b + !c + !d + !e + !f + !g + !h + !i + !j + !k + + !l + !m + !n + !o + !p + !pp + !ps + #ifdef HAVE__BOOL + + !q + !r + !u + !v + !w + !x + !y + !z + !pt + #endif + ); ; return 0; } _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : ac_cv_header_stdbool_h=yes -else +else $as_nop ac_cv_header_stdbool_h=no fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdbool_h" >&5 -$as_echo "$ac_cv_header_stdbool_h" >&6; } - ac_fn_c_check_type "$LINENO" "_Bool" "ac_cv_type__Bool" "$ac_includes_default" -if test "x$ac_cv_type__Bool" = xyes; then : +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_header_stdbool_h" >&5 +printf "%s\n" "$ac_cv_header_stdbool_h" >&6; } -cat >>confdefs.h <<_ACEOF -#define HAVE__BOOL 1 -_ACEOF - - -fi - - -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for inline" >&5 -$as_echo_n "checking for inline... " >&6; } -if ${ac_cv_c_inline+:} false; then : - $as_echo_n "(cached) " >&6 -else +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for inline" >&5 +printf %s "checking for inline... " >&6; } +if test ${ac_cv_c_inline+y} +then : + printf %s "(cached) " >&6 +else $as_nop ac_cv_c_inline=no for ac_kw in inline __inline__ __inline; do cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #ifndef __cplusplus typedef int foo_t; -static $ac_kw foo_t static_foo () {return 0; } -$ac_kw foo_t foo () {return 0; } +static $ac_kw foo_t static_foo (void) {return 0; } +$ac_kw foo_t foo (void) {return 0; } #endif _ACEOF -if ac_fn_c_try_compile "$LINENO"; then : +if ac_fn_c_try_compile "$LINENO" +then : ac_cv_c_inline=$ac_kw fi -rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +rm -f core conftest.err conftest.$ac_objext conftest.beam conftest.$ac_ext test "$ac_cv_c_inline" != no && break done fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_inline" >&5 -$as_echo "$ac_cv_c_inline" >&6; } +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_c_inline" >&5 +printf "%s\n" "$ac_cv_c_inline" >&6; } case $ac_cv_c_inline in inline | yes) ;; @@ -4382,24 +4967,22 @@ _ACEOF esac ac_fn_c_check_type "$LINENO" "size_t" "ac_cv_type_size_t" "$ac_includes_default" -if test "x$ac_cv_type_size_t" = xyes; then : +if test "x$ac_cv_type_size_t" = xyes +then : -else +else $as_nop -cat >>confdefs.h <<_ACEOF -#define size_t unsigned int -_ACEOF +printf "%s\n" "#define size_t unsigned int" >>confdefs.h fi ac_fn_c_check_type "$LINENO" "ssize_t" "ac_cv_type_ssize_t" "$ac_includes_default" -if test "x$ac_cv_type_ssize_t" = xyes; then : +if test "x$ac_cv_type_ssize_t" = xyes +then : -else +else $as_nop -cat >>confdefs.h <<_ACEOF -#define ssize_t int -_ACEOF +printf "%s\n" "#define ssize_t int" >>confdefs.h fi @@ -4409,9 +4992,7 @@ case $ac_cv_c_uint16_t in #( *) -cat >>confdefs.h <<_ACEOF -#define uint16_t $ac_cv_c_uint16_t -_ACEOF +printf "%s\n" "#define uint16_t $ac_cv_c_uint16_t" >>confdefs.h ;; esac @@ -4420,12 +5001,10 @@ case $ac_cv_c_uint32_t in #( no|yes) ;; #( *) -$as_echo "#define _UINT32_T 1" >>confdefs.h +printf "%s\n" "#define _UINT32_T 1" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define uint32_t $ac_cv_c_uint32_t -_ACEOF +printf "%s\n" "#define uint32_t $ac_cv_c_uint32_t" >>confdefs.h ;; esac @@ -4434,12 +5013,10 @@ case $ac_cv_c_uint64_t in #( no|yes) ;; #( *) -$as_echo "#define _UINT64_T 1" >>confdefs.h +printf "%s\n" "#define _UINT64_T 1" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define uint64_t $ac_cv_c_uint64_t -_ACEOF +printf "%s\n" "#define uint64_t $ac_cv_c_uint64_t" >>confdefs.h ;; esac @@ -4448,12 +5025,10 @@ case $ac_cv_c_uint8_t in #( no|yes) ;; #( *) -$as_echo "#define _UINT8_T 1" >>confdefs.h +printf "%s\n" "#define _UINT8_T 1" >>confdefs.h -cat >>confdefs.h <<_ACEOF -#define uint8_t $ac_cv_c_uint8_t -_ACEOF +printf "%s\n" "#define uint8_t $ac_cv_c_uint8_t" >>confdefs.h ;; esac @@ -4462,9 +5037,7 @@ case $ac_cv_c_int16_t in #( no|yes) ;; #( *) -cat >>confdefs.h <<_ACEOF -#define int16_t $ac_cv_c_int16_t -_ACEOF +printf "%s\n" "#define int16_t $ac_cv_c_int16_t" >>confdefs.h ;; esac @@ -4473,53 +5046,123 @@ case $ac_cv_c_int32_t in #( no|yes) ;; #( *) -cat >>confdefs.h <<_ACEOF -#define int32_t $ac_cv_c_int32_t -_ACEOF +printf "%s\n" "#define int32_t $ac_cv_c_int32_t" >>confdefs.h ;; esac # Checks for library functions. -for ac_header in stdlib.h -do : - ac_fn_c_check_header_mongrel "$LINENO" "stdlib.h" "ac_cv_header_stdlib_h" "$ac_includes_default" -if test "x$ac_cv_header_stdlib_h" = xyes; then : - cat >>confdefs.h <<_ACEOF -#define HAVE_STDLIB_H 1 -_ACEOF - -fi -done -{ $as_echo "$as_me:${as_lineno-$LINENO}: checking for GNU libc compatible malloc" >&5 -$as_echo_n "checking for GNU libc compatible malloc... " >&6; } -if ${ac_cv_func_malloc_0_nonnull+:} false; then : - $as_echo_n "(cached) " >&6 -else - if test "$cross_compiling" = yes; then : - ac_cv_func_malloc_0_nonnull=no -else + # Make sure we can run config.sub. +$SHELL "${ac_aux_dir}config.sub" sun4 >/dev/null 2>&1 || + as_fn_error $? "cannot run $SHELL ${ac_aux_dir}config.sub" "$LINENO" 5 + +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking build system type" >&5 +printf %s "checking build system type... " >&6; } +if test ${ac_cv_build+y} +then : + printf %s "(cached) " >&6 +else $as_nop + ac_build_alias=$build_alias +test "x$ac_build_alias" = x && + ac_build_alias=`$SHELL "${ac_aux_dir}config.guess"` +test "x$ac_build_alias" = x && + as_fn_error $? "cannot guess build type; you must specify one" "$LINENO" 5 +ac_cv_build=`$SHELL "${ac_aux_dir}config.sub" $ac_build_alias` || + as_fn_error $? "$SHELL ${ac_aux_dir}config.sub $ac_build_alias failed" "$LINENO" 5 + +fi +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_build" >&5 +printf "%s\n" "$ac_cv_build" >&6; } +case $ac_cv_build in +*-*-*) ;; +*) as_fn_error $? "invalid value of canonical build" "$LINENO" 5;; +esac +build=$ac_cv_build +ac_save_IFS=$IFS; IFS='-' +set x $ac_cv_build +shift +build_cpu=$1 +build_vendor=$2 +shift; shift +# Remember, the first character of IFS is used to create $*, +# except with old shells: +build_os=$* +IFS=$ac_save_IFS +case $build_os in *\ *) build_os=`echo "$build_os" | sed 's/ /-/g'`;; esac + + +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking host system type" >&5 +printf %s "checking host system type... " >&6; } +if test ${ac_cv_host+y} +then : + printf %s "(cached) " >&6 +else $as_nop + if test "x$host_alias" = x; then + ac_cv_host=$ac_cv_build +else + ac_cv_host=`$SHELL "${ac_aux_dir}config.sub" $host_alias` || + as_fn_error $? "$SHELL ${ac_aux_dir}config.sub $host_alias failed" "$LINENO" 5 +fi + +fi +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_host" >&5 +printf "%s\n" "$ac_cv_host" >&6; } +case $ac_cv_host in +*-*-*) ;; +*) as_fn_error $? "invalid value of canonical host" "$LINENO" 5;; +esac +host=$ac_cv_host +ac_save_IFS=$IFS; IFS='-' +set x $ac_cv_host +shift +host_cpu=$1 +host_vendor=$2 +shift; shift +# Remember, the first character of IFS is used to create $*, +# except with old shells: +host_os=$* +IFS=$ac_save_IFS +case $host_os in *\ *) host_os=`echo "$host_os" | sed 's/ /-/g'`;; esac + + +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: checking for GNU libc compatible malloc" >&5 +printf %s "checking for GNU libc compatible malloc... " >&6; } +if test ${ac_cv_func_malloc_0_nonnull+y} +then : + printf %s "(cached) " >&6 +else $as_nop + if test "$cross_compiling" = yes +then : + case "$host_os" in # (( + # Guess yes on platforms where we know the result. + *-gnu* | freebsd* | netbsd* | openbsd* | bitrig* \ + | hpux* | solaris* | cygwin* | mingw* | msys* ) + ac_cv_func_malloc_0_nonnull=yes ;; + # If we don't know, assume the worst. + *) ac_cv_func_malloc_0_nonnull=no ;; + esac +else $as_nop cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ -#if defined STDC_HEADERS || defined HAVE_STDLIB_H -# include -#else -char *malloc (); -#endif +#include int -main () +main (void) { -return ! malloc (0); +void *p = malloc (0); + int result = !p; + free (p); + return result; ; return 0; } _ACEOF -if ac_fn_c_try_run "$LINENO"; then : +if ac_fn_c_try_run "$LINENO" +then : ac_cv_func_malloc_0_nonnull=yes -else +else $as_nop ac_cv_func_malloc_0_nonnull=no fi rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \ @@ -4527,14 +5170,15 @@ rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext \ fi fi -{ $as_echo "$as_me:${as_lineno-$LINENO}: result: $ac_cv_func_malloc_0_nonnull" >&5 -$as_echo "$ac_cv_func_malloc_0_nonnull" >&6; } -if test $ac_cv_func_malloc_0_nonnull = yes; then : +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: result: $ac_cv_func_malloc_0_nonnull" >&5 +printf "%s\n" "$ac_cv_func_malloc_0_nonnull" >&6; } +if test $ac_cv_func_malloc_0_nonnull = yes +then : -$as_echo "#define HAVE_MALLOC 1" >>confdefs.h +printf "%s\n" "#define HAVE_MALLOC 1" >>confdefs.h -else - $as_echo "#define HAVE_MALLOC 0" >>confdefs.h +else $as_nop + printf "%s\n" "#define HAVE_MALLOC 0" >>confdefs.h case " $LIBOBJS " in *" malloc.$ac_objext "* ) ;; @@ -4543,22 +5187,23 @@ else esac -$as_echo "#define malloc rpl_malloc" >>confdefs.h +printf "%s\n" "#define malloc rpl_malloc" >>confdefs.h fi -for ac_func in memset strerror -do : - as_ac_var=`$as_echo "ac_cv_func_$ac_func" | $as_tr_sh` -ac_fn_c_check_func "$LINENO" "$ac_func" "$as_ac_var" -if eval test \"x\$"$as_ac_var"\" = x"yes"; then : - cat >>confdefs.h <<_ACEOF -#define `$as_echo "HAVE_$ac_func" | $as_tr_cpp` 1 -_ACEOF +ac_fn_c_check_func "$LINENO" "memset" "ac_cv_func_memset" +if test "x$ac_cv_func_memset" = xyes +then : + printf "%s\n" "#define HAVE_MEMSET 1" >>confdefs.h + +fi +ac_fn_c_check_func "$LINENO" "strerror" "ac_cv_func_strerror" +if test "x$ac_cv_func_strerror" = xyes +then : + printf "%s\n" "#define HAVE_STRERROR 1" >>confdefs.h fi -done ac_config_files="$ac_config_files Makefile src/Makefile" @@ -4590,8 +5235,8 @@ _ACEOF case $ac_val in #( *${as_nl}*) case $ac_var in #( - *_cv_*) { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 -$as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; + *_cv_*) { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: cache variable $ac_var contains a newline" >&5 +printf "%s\n" "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; esac case $ac_var in #( _ | IFS | as_nl) ;; #( @@ -4621,15 +5266,15 @@ $as_echo "$as_me: WARNING: cache variable $ac_var contains a newline" >&2;} ;; /^ac_cv_env_/b end t clear :clear - s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ + s/^\([^=]*\)=\(.*[{}].*\)$/test ${\1+y} || &/ t end s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ :end' >>confcache if diff "$cache_file" confcache >/dev/null 2>&1; then :; else if test -w "$cache_file"; then if test "x$cache_file" != "x/dev/null"; then - { $as_echo "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5 -$as_echo "$as_me: updating cache $cache_file" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: updating cache $cache_file" >&5 +printf "%s\n" "$as_me: updating cache $cache_file" >&6;} if test ! -f "$cache_file" || test -h "$cache_file"; then cat confcache >"$cache_file" else @@ -4643,8 +5288,8 @@ $as_echo "$as_me: updating cache $cache_file" >&6;} fi fi else - { $as_echo "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5 -$as_echo "$as_me: not updating unwritable cache $cache_file" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: not updating unwritable cache $cache_file" >&5 +printf "%s\n" "$as_me: not updating unwritable cache $cache_file" >&6;} fi fi rm -f confcache @@ -4661,7 +5306,7 @@ U= for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue # 1. Remove the extension, and $U if already installed. ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' - ac_i=`$as_echo "$ac_i" | sed "$ac_script"` + ac_i=`printf "%s\n" "$ac_i" | sed "$ac_script"` # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR # will be set to the directory where LIBOBJS objects are built. as_fn_append ac_libobjs " \${LIBOBJDIR}$ac_i\$U.$ac_objext" @@ -4677,8 +5322,8 @@ LTLIBOBJS=$ac_ltlibobjs ac_write_fail=0 ac_clean_files_save=$ac_clean_files ac_clean_files="$ac_clean_files $CONFIG_STATUS" -{ $as_echo "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5 -$as_echo "$as_me: creating $CONFIG_STATUS" >&6;} +{ printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating $CONFIG_STATUS" >&5 +printf "%s\n" "$as_me: creating $CONFIG_STATUS" >&6;} as_write_fail=0 cat >$CONFIG_STATUS <<_ASEOF || as_write_fail=1 #! $SHELL @@ -4701,14 +5346,16 @@ cat >>$CONFIG_STATUS <<\_ASEOF || as_write_fail=1 # Be more Bourne compatible DUALCASE=1; export DUALCASE # for MKS sh -if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then : +as_nop=: +if test ${ZSH_VERSION+y} && (emulate sh) >/dev/null 2>&1 +then : emulate sh NULLCMD=: # Pre-4.2 versions of Zsh do word splitting on ${1+"$@"}, which # is contrary to our usage. Disable this feature. alias -g '${1+"$@"}'='"$@"' setopt NO_GLOB_SUBST -else +else $as_nop case `(set -o) 2>/dev/null` in #( *posix*) : set -o posix ;; #( @@ -4718,46 +5365,46 @@ esac fi + +# Reset variables that may have inherited troublesome values from +# the environment. + +# IFS needs to be set, to space, tab, and newline, in precisely that order. +# (If _AS_PATH_WALK were called with IFS unset, it would have the +# side effect of setting IFS to empty, thus disabling word splitting.) +# Quoting is to prevent editors from complaining about space-tab. as_nl=' ' export as_nl -# Printing a long string crashes Solaris 7 /usr/bin/printf. -as_echo='\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\' -as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo -as_echo=$as_echo$as_echo$as_echo$as_echo$as_echo$as_echo -# Prefer a ksh shell builtin over an external printf program on Solaris, -# but without wasting forks for bash or zsh. -if test -z "$BASH_VERSION$ZSH_VERSION" \ - && (test "X`print -r -- $as_echo`" = "X$as_echo") 2>/dev/null; then - as_echo='print -r --' - as_echo_n='print -rn --' -elif (test "X`printf %s $as_echo`" = "X$as_echo") 2>/dev/null; then - as_echo='printf %s\n' - as_echo_n='printf %s' -else - if test "X`(/usr/ucb/echo -n -n $as_echo) 2>/dev/null`" = "X-n $as_echo"; then - as_echo_body='eval /usr/ucb/echo -n "$1$as_nl"' - as_echo_n='/usr/ucb/echo -n' - else - as_echo_body='eval expr "X$1" : "X\\(.*\\)"' - as_echo_n_body='eval - arg=$1; - case $arg in #( - *"$as_nl"*) - expr "X$arg" : "X\\(.*\\)$as_nl"; - arg=`expr "X$arg" : ".*$as_nl\\(.*\\)"`;; - esac; - expr "X$arg" : "X\\(.*\\)" | tr -d "$as_nl" - ' - export as_echo_n_body - as_echo_n='sh -c $as_echo_n_body as_echo' - fi - export as_echo_body - as_echo='sh -c $as_echo_body as_echo' -fi +IFS=" "" $as_nl" + +PS1='$ ' +PS2='> ' +PS4='+ ' + +# Ensure predictable behavior from utilities with locale-dependent output. +LC_ALL=C +export LC_ALL +LANGUAGE=C +export LANGUAGE + +# We cannot yet rely on "unset" to work, but we need these variables +# to be unset--not just set to an empty or harmless value--now, to +# avoid bugs in old shells (e.g. pre-3.0 UWIN ksh). This construct +# also avoids known problems related to "unset" and subshell syntax +# in other old shells (e.g. bash 2.01 and pdksh 5.2.14). +for as_var in BASH_ENV ENV MAIL MAILPATH CDPATH +do eval test \${$as_var+y} \ + && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : +done + +# Ensure that fds 0, 1, and 2 are open. +if (exec 3>&0) 2>/dev/null; then :; else exec 0&1) 2>/dev/null; then :; else exec 1>/dev/null; fi +if (exec 3>&2) ; then :; else exec 2>/dev/null; fi # The user is always right. -if test "${PATH_SEPARATOR+set}" != set; then +if ${PATH_SEPARATOR+false} :; then PATH_SEPARATOR=: (PATH='/bin;/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 && { (PATH='/bin:/bin'; FPATH=$PATH; sh -c :) >/dev/null 2>&1 || @@ -4766,13 +5413,6 @@ if test "${PATH_SEPARATOR+set}" != set; then fi -# IFS -# We need space, tab and new line, in precisely that order. Quoting is -# there to prevent editors from complaining about space-tab. -# (If _AS_PATH_WALK were called with IFS unset, it would disable word -# splitting by setting IFS to empty value.) -IFS=" "" $as_nl" - # Find who we are. Look in the path if we contain no directory separator. as_myself= case $0 in #(( @@ -4781,8 +5421,12 @@ case $0 in #(( for as_dir in $PATH do IFS=$as_save_IFS - test -z "$as_dir" && as_dir=. - test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break + case $as_dir in #((( + '') as_dir=./ ;; + */) ;; + *) as_dir=$as_dir/ ;; + esac + test -r "$as_dir$0" && as_myself=$as_dir$0 && break done IFS=$as_save_IFS @@ -4794,30 +5438,10 @@ if test "x$as_myself" = x; then as_myself=$0 fi if test ! -f "$as_myself"; then - $as_echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 + printf "%s\n" "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 exit 1 fi -# Unset variables that we do not need and which cause bugs (e.g. in -# pre-3.0 UWIN ksh). But do not cause bugs in bash 2.01; the "|| exit 1" -# suppresses any "Segmentation fault" message there. '((' could -# trigger a bug in pdksh 5.2.14. -for as_var in BASH_ENV ENV MAIL MAILPATH -do eval test x\${$as_var+set} = xset \ - && ( (unset $as_var) || exit 1) >/dev/null 2>&1 && unset $as_var || : -done -PS1='$ ' -PS2='> ' -PS4='+ ' - -# NLS nuisances. -LC_ALL=C -export LC_ALL -LANGUAGE=C -export LANGUAGE - -# CDPATH. -(unset CDPATH) >/dev/null 2>&1 && unset CDPATH # as_fn_error STATUS ERROR [LINENO LOG_FD] @@ -4830,13 +5454,14 @@ as_fn_error () as_status=$1; test $as_status -eq 0 && as_status=1 if test "$4"; then as_lineno=${as_lineno-"$3"} as_lineno_stack=as_lineno_stack=$as_lineno_stack - $as_echo "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 + printf "%s\n" "$as_me:${as_lineno-$LINENO}: error: $2" >&$4 fi - $as_echo "$as_me: error: $2" >&2 + printf "%s\n" "$as_me: error: $2" >&2 as_fn_exit $as_status } # as_fn_error + # as_fn_set_status STATUS # ----------------------- # Set $? to STATUS, without forking. @@ -4863,18 +5488,20 @@ as_fn_unset () { eval $1=; unset $1;} } as_unset=as_fn_unset + # as_fn_append VAR VALUE # ---------------------- # Append the text in VALUE to the end of the definition contained in VAR. Take # advantage of any shell optimizations that allow amortized linear growth over # repeated appends, instead of the typical quadratic growth present in naive # implementations. -if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null; then : +if (eval "as_var=1; as_var+=2; test x\$as_var = x12") 2>/dev/null +then : eval 'as_fn_append () { eval $1+=\$2 }' -else +else $as_nop as_fn_append () { eval $1=\$$1\$2 @@ -4886,12 +5513,13 @@ fi # as_fn_append # Perform arithmetic evaluation on the ARGs, and store the result in the # global $as_val. Take advantage of shells that can avoid forks. The arguments # must be portable across $(()) and expr. -if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null; then : +if (eval "test \$(( 1 + 1 )) = 2") 2>/dev/null +then : eval 'as_fn_arith () { as_val=$(( $* )) }' -else +else $as_nop as_fn_arith () { as_val=`expr "$@" || test $? -eq 1` @@ -4922,7 +5550,7 @@ as_me=`$as_basename -- "$0" || $as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ X"$0" : 'X\(//\)$' \| \ X"$0" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X/"$0" | +printf "%s\n" X/"$0" | sed '/^.*\/\([^/][^/]*\)\/*$/{ s//\1/ q @@ -4944,6 +5572,10 @@ as_cr_Letters=$as_cr_letters$as_cr_LETTERS as_cr_digits='0123456789' as_cr_alnum=$as_cr_Letters$as_cr_digits + +# Determine whether it's possible to make 'echo' print without a newline. +# These variables are no longer used directly by Autoconf, but are AC_SUBSTed +# for compatibility with existing Makefiles. ECHO_C= ECHO_N= ECHO_T= case `echo -n x` in #((((( -n*) @@ -4957,6 +5589,12 @@ case `echo -n x` in #((((( ECHO_N='-n';; esac +# For backward compatibility with old third-party macros, we provide +# the shell variables $as_echo and $as_echo_n. New code should use +# AS_ECHO(["message"]) and AS_ECHO_N(["message"]), respectively. +as_echo='printf %s\n' +as_echo_n='printf %s' + rm -f conf$$ conf$$.exe conf$$.file if test -d conf$$.dir; then rm -f conf$$.dir/conf$$.file @@ -4998,7 +5636,7 @@ as_fn_mkdir_p () as_dirs= while :; do case $as_dir in #( - *\'*) as_qdir=`$as_echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( + *\'*) as_qdir=`printf "%s\n" "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #'( *) as_qdir=$as_dir;; esac as_dirs="'$as_qdir' $as_dirs" @@ -5007,7 +5645,7 @@ $as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$as_dir" : 'X\(//\)[^/]' \| \ X"$as_dir" : 'X\(//\)$' \| \ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X"$as_dir" | +printf "%s\n" X"$as_dir" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q @@ -5069,8 +5707,8 @@ cat >>$CONFIG_STATUS <<\_ACEOF || ac_write_fail=1 # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" -This file was extended by seedtool-cli $as_me 0.10.2, which was -generated by GNU Autoconf 2.69. Invocation command line was +This file was extended by seedtool-cli $as_me 0.11.0, which was +generated by GNU Autoconf 2.71. Invocation command line was CONFIG_FILES = $CONFIG_FILES CONFIG_HEADERS = $CONFIG_HEADERS @@ -5128,14 +5766,16 @@ $config_headers Report bugs to the package provider." _ACEOF +ac_cs_config=`printf "%s\n" "$ac_configure_args" | sed "$ac_safe_unquote"` +ac_cs_config_escaped=`printf "%s\n" "$ac_cs_config" | sed "s/^ //; s/'/'\\\\\\\\''/g"` cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 -ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`" +ac_cs_config='$ac_cs_config_escaped' ac_cs_version="\\ -seedtool-cli config.status 0.10.2 -configured by $0, generated by GNU Autoconf 2.69, +seedtool-cli config.status 0.11.0 +configured by $0, generated by GNU Autoconf 2.71, with options \\"\$ac_cs_config\\" -Copyright (C) 2012 Free Software Foundation, Inc. +Copyright (C) 2021 Free Software Foundation, Inc. This config.status script is free software; the Free Software Foundation gives unlimited permission to copy, distribute and modify it." @@ -5173,15 +5813,15 @@ do -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) ac_cs_recheck=: ;; --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) - $as_echo "$ac_cs_version"; exit ;; + printf "%s\n" "$ac_cs_version"; exit ;; --config | --confi | --conf | --con | --co | --c ) - $as_echo "$ac_cs_config"; exit ;; + printf "%s\n" "$ac_cs_config"; exit ;; --debug | --debu | --deb | --de | --d | -d ) debug=: ;; --file | --fil | --fi | --f ) $ac_shift case $ac_optarg in - *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; + *\'*) ac_optarg=`printf "%s\n" "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; '') as_fn_error $? "missing file argument" ;; esac as_fn_append CONFIG_FILES " '$ac_optarg'" @@ -5189,7 +5829,7 @@ do --header | --heade | --head | --hea ) $ac_shift case $ac_optarg in - *\'*) ac_optarg=`$as_echo "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; + *\'*) ac_optarg=`printf "%s\n" "$ac_optarg" | sed "s/'/'\\\\\\\\''/g"` ;; esac as_fn_append CONFIG_HEADERS " '$ac_optarg'" ac_need_defaults=false;; @@ -5198,7 +5838,7 @@ do as_fn_error $? "ambiguous option: \`$1' Try \`$0 --help' for more information.";; --help | --hel | -h ) - $as_echo "$ac_cs_usage"; exit ;; + printf "%s\n" "$ac_cs_usage"; exit ;; -q | -quiet | --quiet | --quie | --qui | --qu | --q \ | -silent | --silent | --silen | --sile | --sil | --si | --s) ac_cs_silent=: ;; @@ -5226,7 +5866,7 @@ cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 if \$ac_cs_recheck; then set X $SHELL '$0' $ac_configure_args \$ac_configure_extra_args --no-create --no-recursion shift - \$as_echo "running CONFIG_SHELL=$SHELL \$*" >&6 + \printf "%s\n" "running CONFIG_SHELL=$SHELL \$*" >&6 CONFIG_SHELL='$SHELL' export CONFIG_SHELL exec "\$@" @@ -5240,7 +5880,7 @@ exec 5>>config.log sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX ## Running $as_me. ## _ASBOX - $as_echo "$ac_log" + printf "%s\n" "$ac_log" } >&5 _ACEOF @@ -5267,8 +5907,8 @@ done # We use the long form for the default assignment because of an extremely # bizarre bug on SunOS 4.1.3. if $ac_need_defaults; then - test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files - test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers + test ${CONFIG_FILES+y} || CONFIG_FILES=$config_files + test ${CONFIG_HEADERS+y} || CONFIG_HEADERS=$config_headers fi # Have a temporary directory for convenience. Make it in the build tree @@ -5604,7 +6244,7 @@ do esac || as_fn_error 1 "cannot find input file: \`$ac_f'" "$LINENO" 5;; esac - case $ac_f in *\'*) ac_f=`$as_echo "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac + case $ac_f in *\'*) ac_f=`printf "%s\n" "$ac_f" | sed "s/'/'\\\\\\\\''/g"`;; esac as_fn_append ac_file_inputs " '$ac_f'" done @@ -5612,17 +6252,17 @@ do # use $as_me), people would be surprised to read: # /* config.h. Generated by config.status. */ configure_input='Generated from '` - $as_echo "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' + printf "%s\n" "$*" | sed 's|^[^:]*/||;s|:[^:]*/|, |g' `' by configure.' if test x"$ac_file" != x-; then configure_input="$ac_file. $configure_input" - { $as_echo "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 -$as_echo "$as_me: creating $ac_file" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: creating $ac_file" >&5 +printf "%s\n" "$as_me: creating $ac_file" >&6;} fi # Neutralize special characters interpreted by sed in replacement strings. case $configure_input in #( *\&* | *\|* | *\\* ) - ac_sed_conf_input=`$as_echo "$configure_input" | + ac_sed_conf_input=`printf "%s\n" "$configure_input" | sed 's/[\\\\&|]/\\\\&/g'`;; #( *) ac_sed_conf_input=$configure_input;; esac @@ -5639,7 +6279,7 @@ $as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$ac_file" : 'X\(//\)[^/]' \| \ X"$ac_file" : 'X\(//\)$' \| \ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || -$as_echo X"$ac_file" | +printf "%s\n" X"$ac_file" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q @@ -5663,9 +6303,9 @@ $as_echo X"$ac_file" | case "$ac_dir" in .) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; *) - ac_dir_suffix=/`$as_echo "$ac_dir" | sed 's|^\.[\\/]||'` + ac_dir_suffix=/`printf "%s\n" "$ac_dir" | sed 's|^\.[\\/]||'` # A ".." for each directory in $ac_dir_suffix. - ac_top_builddir_sub=`$as_echo "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` + ac_top_builddir_sub=`printf "%s\n" "$ac_dir_suffix" | sed 's|/[^\\/]*|/..|g;s|/||'` case $ac_top_builddir_sub in "") ac_top_builddir_sub=. ac_top_build_prefix= ;; *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; @@ -5722,8 +6362,8 @@ ac_sed_dataroot=' case `eval "sed -n \"\$ac_sed_dataroot\" $ac_file_inputs"` in *datarootdir*) ac_datarootdir_seen=yes;; *@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 -$as_echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 +printf "%s\n" "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} _ACEOF cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_datarootdir_hack=' @@ -5766,9 +6406,9 @@ test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && { ac_out=`sed -n '/\${datarootdir}/p' "$ac_tmp/out"`; test -n "$ac_out"; } && { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' \ "$ac_tmp/out"`; test -z "$ac_out"; } && - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&5 -$as_echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' +printf "%s\n" "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' which seems to be undefined. Please make sure it is defined" >&2;} rm -f "$ac_tmp/stdin" @@ -5784,20 +6424,20 @@ which seems to be undefined. Please make sure it is defined" >&2;} # if test x"$ac_file" != x-; then { - $as_echo "/* $configure_input */" \ + printf "%s\n" "/* $configure_input */" >&1 \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" } >"$ac_tmp/config.h" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 if diff "$ac_file" "$ac_tmp/config.h" >/dev/null 2>&1; then - { $as_echo "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5 -$as_echo "$as_me: $ac_file is unchanged" >&6;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: $ac_file is unchanged" >&5 +printf "%s\n" "$as_me: $ac_file is unchanged" >&6;} else rm -f "$ac_file" mv "$ac_tmp/config.h" "$ac_file" \ || as_fn_error $? "could not create $ac_file" "$LINENO" 5 fi else - $as_echo "/* $configure_input */" \ + printf "%s\n" "/* $configure_input */" >&1 \ && eval '$AWK -f "$ac_tmp/defines.awk"' "$ac_file_inputs" \ || as_fn_error $? "could not create -" "$LINENO" 5 fi @@ -5838,7 +6478,8 @@ if test "$no_create" != yes; then $ac_cs_success || as_fn_exit 1 fi if test -n "$ac_unrecognized_opts" && test "$enable_option_checking" != no; then - { $as_echo "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 -$as_echo "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} + { printf "%s\n" "$as_me:${as_lineno-$LINENO}: WARNING: unrecognized options: $ac_unrecognized_opts" >&5 +printf "%s\n" "$as_me: WARNING: unrecognized options: $ac_unrecognized_opts" >&2;} fi + diff --git a/configure.ac b/configure.ac index 8f33009..c24da66 100644 --- a/configure.ac +++ b/configure.ac @@ -2,9 +2,10 @@ # Process this file with autoconf to produce a configure script. AC_PREREQ([2.69]) -AC_INIT([seedtool-cli], [0.10.2]) +AC_INIT([seedtool-cli], [0.11.0]) AC_CONFIG_SRCDIR([src/seedtool.cpp]) AC_CONFIG_HEADERS([src/config.h]) +AC_CONFIG_AUX_DIR([build-aux]) # Checks for programs. AC_PROG_CXX diff --git a/src/config.h.in b/src/config.h.in index 53dfd94..42f5fc9 100644 --- a/src/config.h.in +++ b/src/config.h.in @@ -40,6 +40,9 @@ /* Define to 1 if you have the header file. */ #undef HAVE_STDINT_H +/* Define to 1 if you have the header file. */ +#undef HAVE_STDIO_H + /* Define to 1 if you have the header file. */ #undef HAVE_STDLIB_H @@ -88,7 +91,9 @@ /* Define to the version of this package. */ #undef PACKAGE_VERSION -/* Define to 1 if you have the ANSI C header files. */ +/* Define to 1 if all of the C90 standard headers exist (not just the ones + required in a freestanding environment). This macro is provided for + backward compatibility; new code need not use it. */ #undef STDC_HEADERS /* Define for Solaris 2.5.1 so the uint32_t typedef from , diff --git a/src/format-hex.cpp b/src/format-hex.cpp index 5fa8bde..dce2780 100644 --- a/src/format-hex.cpp +++ b/src/format-hex.cpp @@ -49,7 +49,7 @@ void FormatHex::process_output(Params* p) { encode_byte_string(byte_string, p->seed); ByteVector dict; encode_dict_with_birthdate(dict, byte_string, false); - p->set_ur_output(dict, "crypto-seed"); + p->set_ur_output(dict, "seed"); } else { p->output = data_to_hex(p->seed); } diff --git a/src/params.cpp b/src/params.cpp index d974284..9e09087 100644 --- a/src/params.cpp +++ b/src/params.cpp @@ -313,7 +313,7 @@ void Params::validate_input() { argp_error(state, "Incomplete UR parts."); } else { auto type = ur_shares.front().type(); - if(type == "crypto-seed") { + if(type == "seed" || type == "crypto-seed") { input_format = new FormatHex(); } else if(type == "crypto-bip39") { input_format = new FormatBIP39(); diff --git a/src/test.sh b/src/test.sh index 8083f71..ad0e949 100755 --- a/src/test.sh +++ b/src/test.sh @@ -212,55 +212,55 @@ testInSSKR2Of3() testOutUR() { # seedtool --deterministic TEST --ur - assertEquals $'ur:crypto-seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb' \ + assertEquals $'ur:seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb' \ "$(${SEEDTOOL} --ur)" } testInUR() { assertEquals $'9d347f841a4e2ce6bc886e1aee74d824' \ - "$(${SEEDTOOL} --in ur ur:crypto-seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb)" + "$(${SEEDTOOL} --in ur ur:seed/oyadgdnteelblrcygldwvarflojtcywyjytpdkjspafltb)" } testOutMultipartUR() { - assertEquals $'ur:crypto-seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs -ur:crypto-seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd -ur:crypto-seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft -ur:crypto-seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs -ur:crypto-seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe' \ + assertEquals $'ur:seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs +ur:seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd +ur:seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft +ur:seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs +ur:seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe' \ "$(${SEEDTOOL} --count 400 --ur=100)" } testInMultipartUR() { assertEquals $'9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af41b0378c9d7a54e44ebdac8005d681e7c8a6a9aa47cc9543742d6765870cecb05a648ddd5aeaa865087ba12136d530798ee42613db336b6b9e0ac07ce2d922ab71e7555ae4ed9a9ff7457d5722854e70684fe4bb927b89f8e8336b6019e67b3116b86fed' \ - "$(${SEEDTOOL} --in ur 'ur:crypto-seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs' \ -'ur:crypto-seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd' \ -'ur:crypto-seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft' \ -'ur:crypto-seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs' \ -'ur:crypto-seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe')" + "$(${SEEDTOOL} --in ur 'ur:seed/1-5/lpadahcfadmdcyknoxqdgohdgyoyadhkadmhnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszoyknbvavs' \ +'ur:seed/2-5/lpaoahcfadmdcyknoxqdgohdgygmdstpoennbtflwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlbmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnsdeesecrd' \ +'ur:seed/3-5/lpaxahcfadmdcyknoxqdgohdgypscsutkkiyfzeyvtyajlvlsewnhkjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspriymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrydwlamdft' \ +'ur:seed/4-5/lpaaahcfadmdcyknoxqdgohdgywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmnecvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpefppfemlkntknghveglrypslaahtblyvdspolptcpaxrpgs' \ +'ur:seed/5-5/lpahahcfadmdcyknoxqdgohdgypkflsfmdfxjydpioihltbnwppfhtielguthtwdpdihaykgoyclentldykkmnvedsbwuyeojejennbkrtkevotacppyjsvdgohtvewenyneylfekihgcplpgljoisgwverkmokgldyavseojehncfvakgehcmrojlwezmdnkkwe')" } testOutFountainUR() { - assertEquals $'ur:crypto-seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr -ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn -ur:crypto-seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest -ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt -ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki -ur:crypto-seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn -ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl -ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp -ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk -ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl -ur:crypto-seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti -ur:crypto-seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg -ur:crypto-seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk -ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk -ur:crypto-seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb -ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd -ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe' \ + assertEquals $'ur:seed/1-7/lpadatcfadehcyetoyioluhddwoyadhkaddwnteelblrcygldwvarflojtcywyjytpdkfwprylienshnjnpluypmamtkmybsjkspvseesawmrltdlnbkaatllr +ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn +ur:seed/3-7/lpaxatcfadehcyetoyioluhddwwykbtpktgwcxdkhtskwkkgmdmdlubblstnoxpkpysotntbcmotbdwfetqzwsckmscadwssgarysfeomohdytfhlblerhdest +ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt +ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki +ur:seed/6-7/lpamatcfadehcyetoyioluhddwiymotofgcemhguskgeflfyfspliorntefgdkykpswzwyrywtpfvwdeecahtdhhvalrnynbtiwnbdctuesabtmneceegwrkkn +ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl +ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp +ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk +ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl +ur:seed/11-7/lpbdatcfadehcyetoyioluhddwehdmfycnkblknsvdotwflfldynferlatkkaxcsdsbelrfgtlkshtlffmhldaryhetyrysnpyvelrtygmimlpwddivdytgsti +ur:seed/12-7/lpbnatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprhtwevebg +ur:seed/13-7/lpbtatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprflksylsk +ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk +ur:seed/15-7/lpbsatcfadehcyetoyioluhddwknfynsdnzsfzbzuogtykzmihnbweneoxvaeelyrhihiduthkemwndalecwtijzbzgarfvdnletrhseinlsgmjpdnfmwlgytb +ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd +ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe' \ "$(${SEEDTOOL} --count 300 --ur=50 --parts 10)" } @@ -268,16 +268,16 @@ testInFountainUR() { assertEquals $'9d347f841a4e2ce6bc886e1aee74d82442b2f7649c606daedbad06cf8f0f73c8e834c2ebb7d2868d75820ab4fb4e45a1004c9f29b8ef2d4d6a94fab0b373615e3bf736a89e9ceb105f2109fb5226d8a29e0d47ee7ed8774f20245ac5f47b95958b1483daa4aaabc9dad616a30bf338b4ef1e971d2cc449bdcc339258f93f7f91a3d067522b085ca6b2f7c72732ce5aed7ae0ef273f13c8d92ffa89b69cac18dd79664032e0f86fe3c1f1596fd2dc582c690f17407d0852932d23798056a424cacae3bfd4e30fe8030f943645fcdf4d86de1b45570778b26692ce461c9053c54a47443dae67bed34624f5acf2eebdf0b0e5283505d25ce6849aa0d0f10b1fdec20d8e35e6b2072c7fe3d84c4e950c989f0a781a92417732e2076fb302e4cc3ff7506a061a011f4cd4952ff6af' \ "$(${SEEDTOOL} --in ur \ - 'ur:crypto-seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn' \ - 'ur:crypto-seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt' \ - 'ur:crypto-seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki' \ - 'ur:crypto-seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl' \ - 'ur:crypto-seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp' \ - 'ur:crypto-seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk' \ - 'ur:crypto-seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl' \ - 'ur:crypto-seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk' \ - 'ur:crypto-seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd' \ - 'ur:crypto-seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe')" + 'ur:seed/2-7/lpaoatcfadehcyetoyioluhddwlgkplfbkqzzoglfeoyaegsnedtrowsdpgtimmwzspfqdjkhshyfrylenpdnnnswmbeheclaszogmdstpoennbtfljpyaihsn' \ + 'ur:seed/4-7/lpaaatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhksscaimzt' \ + 'ur:seed/5-7/lpahatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatksprpytiinki' \ + 'ur:seed/7-7/lpatatcfadehcyetoyioluhddwvapratdwlbvltpgsglmdbnmknebkkscymofpkteyvoatjlqdaovesffhylgdimamcyadctgstymddlynpeaeaeaerosssfjl' \ + 'ur:seed/8-7/lpayatcfadehcyetoyioluhddwtotelphkaewkfrisssiofgkbkpmepychnyrotiztwylogyfdpflbjllppmtyesdylejktifmglendlltrfpfpkeeglchdakp' \ + 'ur:seed/9-7/lpasatcfadehcyetoyioluhddwmeottiiogmdnayhholprylstdieytohtweknvtwsdifhbwsptadlzsldrpnspscsutkkiyfzeyvtyajlvlsewnhkfxjypdtk' \ + 'ur:seed/10-7/lpbkatcfadehcyetoyioluhddwdwjyuybdmkiyknftdacyaoqdtkaaiofxhglrvtcpmwwnsemtftosmshpamfeehweurtidmkneordbgcygadturseztzekpgl' \ + 'ur:seed/14-7/lpbaatcfadehcyetoyioluhddwylehckclglrkhpnlwpykqdzsldgojoldpyhybzfxtlttpletinsgtdrfqdglwtzehkvlswmhsrwmvdpaclsflbjzctmefdbk' \ + 'ur:seed/16-7/lpbeatcfadehcyetoyioluhddwntknhffwlpnljnghlffrspneaydwcmlgzsvoknnymwnsgoaewtztwnjlptvordgmmdynhhgtwznbynhngloyrktevtmufstd' \ + 'ur:seed/17-7/lpbyatcfadehcyetoyioluhddwjltduohddwinbschfzkiaygmmudpcnkklahfoxdksgsgvlrstyvlbsvsaxbsmwenfezturgtlnuecwfehgatkspruroxcabe')" } testOutSSKRUR()